Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR194 IGR199 IGR198 IGR201 IGR195 IGR196 IGR200 IGR197 MG267 MG268 pdhB, - MG273 lplA, - MG270 MG269 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 leuS, - MG266 MG267 MG268 pdhB, - MG273 lplA, - MG270 MG269 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 leuS, - MG266 Type: tandem, Name:  - 8 MG267 MG268 pdhB, - MG273 lplA, - MG270 MG269 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 leuS, - MG266
* Calculated from Protein Sequence

Gene ID: MG270

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lplA  

Definition:
lipoate-protein ligase

Gene Start:
328442

Gene Stop:
327435

Gene Length:
1008

Molecular Weight*:
38930

pI*:
9.29

Net Charge*:
5.13

EC:
6.-.-.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Lipoate  

Pathway: pathway table
Amino Acid Metabolism; Lysine degradation
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:
This enzyme joins lipoic acid to protein, through an amide linkage between the carboxyl group of lioate and the epsilon-amino group of a lysine residue.


Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to lipoate-protein ligases, e.g. residues 1-336
are 75% similar to LPLA_MYCPN. Rsidues 5-301 are 36% similar to LPLA_ECOLI.
Residues 45-167 are 27% similar to a stretch of CT499, a predicted lipoate-protein ligase from
C.trachomatis. No similarity is seen to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0095 is e-gp--y.
COG name: Lipoate-protein ligase A.
Functional Class: H
BeTs to e,g,y.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-33, 34-169, 170-209, 210-336 constitute defined domains of LPLA_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 47 to 162 (E-value = 1.3e-35) place MG270 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
45  
72

PDB Hit:


Gene Protein Sequence:
MQTFIITSPVFNPYFNAALEEWLLTEFRKNELVKVIYFWQNANTIVVGRN
QNTYAEVNLKELESDKVNLFRRFSGGGAVFHDLGNICFSIILPRTGKVME
NAYEQTTRNVVKFLNSLNVPAVFHGRNDLEINNKKFSGLAEYIAKDRLLV
HGTLLFDTDFSKLAKYLNVDKTKIASKGVDSVAKRVVNVKEYLPNWTTAK
FLEEMINFFTVTEKAETIVLTKDALAKVEKRAKEHFQSWEWNFGKTYEYN
FKNKRYFNNAGLFECNVQVEKGTVVDIKFYGDFLSVVDITPVTKKLIGQK
YDYKTFEKLFNELDHFSDYFGSLKPEQLLGVIFDNK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACTTTCATTATTACTTCCCCTGTTTTCAATCCGTATTTTAATGC
AGCTTTAGAGGAGTGATTGCTAACTGAATTTAGAAAAAATGAGTTAGTTA
AGGTCATCTACTTTTGGCAGAACGCTAACACTATTGTGGTGGGAAGAAAC
CAAAATACTTATGCTGAGGTTAACTTAAAGGAGTTGGAAAGTGATAAGGT
TAACTTGTTTAGACGTTTTTCAGGCGGGGGAGCGGTGTTTCATGACCTTG
GTAACATCTGTTTTTCTATTATTTTGCCAAGAACAGGTAAAGTGATGGAA
AATGCTTATGAACAAACTACAAGAAATGTGGTGAAGTTCTTAAATAGCTT
AAATGTACCTGCTGTATTTCATGGTCGTAATGACCTTGAGATTAATAACA
AGAAGTTTTCTGGGTTAGCTGAATATATCGCTAAAGACAGGTTATTAGTC
CATGGAACATTATTGTTTGACACTGACTTTTCTAAGTTAGCAAAGTATTT
AAATGTTGATAAGACCAAGATAGCAAGTAAGGGTGTTGACAGTGTTGCTA
AGCGCGTTGTTAATGTAAAGGAGTATTTACCAAATTGAACAACAGCAAAA
TTTTTAGAAGAGATGATTAATTTTTTCACTGTTACTGAAAAAGCAGAAAC
AATTGTTTTAACTAAAGATGCACTAGCAAAGGTTGAAAAAAGAGCAAAAG
AACACTTTCAATCATGGGAGTGAAACTTTGGTAAAACTTATGAATACAAC
TTTAAAAACAAGCGTTATTTTAATAATGCTGGTTTATTTGAGTGCAATGT
TCAAGTAGAGAAAGGAACAGTTGTTGATATTAAGTTTTATGGGGACTTTT
TAAGTGTTGTTGATATCACCCCAGTAACAAAAAAACTAATTGGTCAGAAG
TACGATTATAAAACCTTTGAAAAACTCTTCAATGAACTTGATCATTTTAG
TGATTACTTTGGCAGTTTAAAACCTGAGCAACTCTTAGGAGTAATATTTG
ATAACAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy