Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR194 IGR199 IGR198 IGR193 IGR195 IGR196 IGR197 MG267 MG268 MG265 lplA, - MG270 MG269 pdhC, - MG272 pdhD,dldH, - MG271 leuS, - MG266 MG263 MG267 MG268 MG265 lplA, - MG270 MG269 pdhC, - MG272 pdhD,dldH, - MG271 leuS, - MG266 MG263 Type: tandem, Name:  - 8 MG267 MG268 MG265 lplA, - MG270 MG269 pdhC, - MG272 pdhD,dldH, - MG271 leuS, - MG266 MG263 MG264 MG264
* Calculated from Protein Sequence

Gene ID: MG268

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible deoxypurine kinase subunit)

Gene Start:
325877

Gene Stop:
325194

Gene Length:
684

Molecular Weight*:
26877

pI*:
9.74

Net Charge*:
8.96

EC:
2.7.1.113  2.7.1.76  

Functional Class:
Unknown  

Pathway: pathway table
Purine metabolism

Comment:
In lactobacillis, the deoxypurine kinase is a heterodimer.

Blast Summary:  PSI-Blast Search
A few hits in gapped BLAST to hypothetical proteins in bacteria: residues
5-228 are 65% similar to Y268_MYCPN. Residues 3-199 are 24% similar to
YAAF_BACSU, believed to be a deoxypurine kinase subunit. Residues 17-88 are 27% similar to a stretch of TP0058, a predicted replicative DNA helicase in
T.pallidum. No similarity is seen to C.trachomatis.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 16-31 are matched to block PR00364A (disease resistance proteins).
Residues 125-148 are weakly similar to block PR00739C (glycosyl hydrolase family
sequences).

ProDom Summary:  Protein Domain Search
Residues 1-228 constitute a defined domain of Y268_MYCGE. Residues 17-183 are 25%
similar to a domain of YAAF_BACSU. Residues 91-135 are 36% similar to a domain of PEL3_ERWCA.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
17  
35
transmembrane  
194  
215

PDB Hit:


Gene Protein Sequence:
MQLKKPHFQPNKIANCIVIGGMIALGKTTIANTLANHIQAAKVVCELETN
DQLVELLLAKMYERSDELLYSPLFQLYFTLNRFGKYQNNCNTINPTIFDR
SIFEDWLFAKHNIIRPAVFSYYNQLWNRLAKELVNKHGVPNLYVILDGDW
KLFEKRLFMRNRKVEIDNFTKNQLYFQNLHRVYTGFMEAVCNDFGINYCI
IDAKLPIVTIIKMILEKLKLQKLDWKFI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAACTAAAAAAGCCCCATTTTCAACCAAATAAAATTGCTAATTGTAT
TGTGATCGGGGGAATGATTGCTTTAGGAAAAACCACCATTGCTAATACAT
TAGCTAACCACATTCAAGCTGCAAAAGTTGTTTGTGAATTGGAAACTAAT
GACCAGTTGGTTGAACTTTTACTAGCAAAGATGTATGAACGTAGTGATGA
ATTGCTCTATTCACCTTTGTTTCAGCTTTATTTTACGCTTAATCGCTTTG
GTAAATACCAGAACAATTGCAACACTATCAATCCAACCATTTTTGATCGT
TCTATCTTTGAAGACTGGTTGTTTGCTAAGCACAACATCATTCGTCCTGC
AGTCTTTTCATACTATAACCAACTGTGAAATAGATTAGCAAAAGAACTAG
TTAATAAGCATGGGGTTCCTAATTTATATGTCATTTTGGATGGGGATTGA
AAATTATTTGAAAAAAGACTATTTATGCGTAACCGCAAAGTAGAGATTGA
TAACTTTACTAAAAATCAACTTTACTTTCAAAATTTACACAGGGTTTACA
CTGGATTTATGGAAGCGGTTTGTAATGATTTTGGGATTAATTACTGTATT
ATAGATGCAAAACTACCAATAGTAACTATTATTAAAATGATCCTTGAAAA
ATTAAAGTTACAAAAGTTAGATTGAAAATTTATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy