Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR194 IGR198 IGR193 IGR195 IGR196 IGR197 MG267 MG268 MG265 lplA, - MG270 MG269 pdhD,dldH, - MG271 leuS, - MG266 fpg, - MG262.1 MG263 MG262 MG267 MG268 MG265 lplA, - MG270 MG269 pdhD,dldH, - MG271 leuS, - MG266 fpg, - MG262.1 MG263 MG262 MG267 MG268 MG265 lplA, - MG270 MG269 pdhD,dldH, - MG271 leuS, - MG266 fpg, - MG262.1 MG263 MG262 MG264 MG264
* Calculated from Protein Sequence

Gene ID: MG266

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
leuS  

Definition:
leucyl-tRNA synthetase

Gene Start:
324809

Gene Stop:
322434

Gene Length:
2376

Molecular Weight*:
91468

pI*:
9.45

Net Charge*:
13.20

EC:
6.1.1.4  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Valine, leucine and isoleucine biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00161.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to leucyl-tRNA synthetase sequences, e.g.
residues 1-791 are 70% similar to SYL_MYCPN. Residues 2-789 are 41% similar to
SYL_BACSU. Residues 2-790 are 40% similar to CT209, a predicted leucyl-tRNA ligase from
C.trachomatis, and 35% similar to TP0586, the predicted leucyl-tRNA synthetase from T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0495 is ehgpcmy.
COG name: Leucyl-tRNA synthetase.
Functional Class: J
BeTs to e,g,c,y.


Blocks Summary:  Blocks Search
Residues 40-50 and 567-576 are members of blocks BL00178A,B (aminoacyl-tRNA
synthetases). Residues 740-792 and 214-223 are similar to blocks BL00675B,D,
concerned with sigma-54 interaction domains.

ProDom Summary:  Protein Domain Search
Residues 47-157, 219-306, 310-351, 369-404, 475-535, 536-552, 584-608, 625-654,
655-680, 724-749, 750-771, 772-792 constitute defined domains of SYL_MYCGE.
Residues 549-563 are 46% similar to a domain of SYM_HUMAN.

Paralogs:  Local Blast Search
MG266 is paralogously related to MG334, a predicted valyl-tRNA synthetase,
to MG345, a predicted isoleucyl-tRNA synthetase, and to MG021, a predicted
methionyl-tRNA synthetase: residues 2-625 are 21% similar to MG334.

Pfam Summary:  Pfam Search
Residues 10 to 609 (E-value = 1.7e-94) place MG266 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

PDB Hit:


Gene Protein Sequence:
MYNHNLIEEKWLKKWKNKDVNRFESDSNKKKYYVLDMFPYPSAAGLHLGH
VRAYTITDVISRYYKAKGFNVIHPIGFDAFGLPAEQYAINSNQNPGSWTD
QNINNFINQLTSFGFDYDYHLSLKTTDPRYYKYTQWIFSELFKANLAELV
DIDVNWCEQLGTVLANEEVLIDSNGNAVSERGSFSVEKRKMKQWVLKITT
FADALLEGLDTLDWPEPIKEMQRNWIGKSKGVTINFQLKDHKEAIAIFTT
KPQTIFGVSFLAVSTNHWLAKKIAETNKKVASFLKKQLQKTTTLKQKATL
YDGIDLLTNAIHPLTNELIPVYVANYVIEGYGTDAIMGVGAHNENDNFFA
RKQKLKIINVIDKKERLQNSFAYNGLTTKEAQVAITNELISQNKAKLTTV
YKLRDWIFSRQRYWGEPFPIIFDENNTPHLVEQLPVELPLLENYKPDGSG
NSPLMRNQAWVNIVKDNIHYQRETNTMPQWAGSCWYYLGYLMLIKNPNFW
PIDSKEAKKLFDQYLPVDLYVGGAEHAVLHLLYARFWHKFLFDKKLVSTK
EPFQKLINQGMVLGPDGKKMSKSKGNTINPTPLVDSHGADALRLYLMFMG
PISASLTWNDEGLNGMRRWLDRVYNFFFNHAVVTDQVSQETIFAYNLFLK
NSYCHLDKHELNLVISEMMIFLNFLYKTKKISLNYAKGFLTVLSFFAPFL
AEELNEKCGLEPFVVKQAISLVDYQLFETAKTKVILSINGKFKAAKEFTK
GSLEIDVLESFKQDKEINDILNQPIERVVYVQDRIINVLLKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACAATCACAATTTAATTGAAGAAAAGTGGTTAAAAAAATGAAAAAA
CAAAGATGTTAACCGCTTTGAAAGCGATAGTAACAAAAAGAAATATTATG
TCCTTGACATGTTCCCTTATCCCTCAGCAGCAGGATTACATTTAGGACAT
GTTAGAGCTTATACTATCACTGATGTAATAAGTAGGTATTACAAAGCTAA
AGGATTTAATGTGATCCATCCGATTGGTTTTGATGCTTTTGGTTTACCTG
CTGAACAGTATGCTATTAACTCTAATCAAAACCCTGGCAGTTGAACAGAT
CAAAACATTAATAACTTTATTAATCAATTAACTAGTTTTGGTTTTGATTA
TGACTATCATTTAAGTCTCAAAACAACTGATCCACGTTATTACAAATACA
CACAATGGATCTTCAGTGAGCTGTTTAAAGCAAACCTAGCGGAATTAGTT
GATATTGATGTTAATTGGTGTGAACAGCTAGGTACTGTATTGGCTAATGA
AGAAGTTTTAATTGATAGTAATGGCAACGCAGTTAGTGAAAGGGGTTCAT
TTTCAGTTGAAAAACGCAAGATGAAACAGTGAGTTTTGAAAATCACTACT
TTTGCTGATGCACTTCTTGAAGGCTTAGATACACTTGATTGACCTGAACC
AATTAAAGAGATGCAACGGAACTGAATTGGTAAAAGTAAAGGTGTTACTA
TTAACTTTCAACTAAAAGATCATAAGGAAGCTATTGCAATTTTTACAACT
AAACCACAAACAATTTTTGGGGTTAGTTTTCTTGCAGTTTCAACCAACCA
TTGGTTAGCAAAAAAGATAGCAGAAACAAATAAAAAAGTAGCTAGTTTTT
TAAAAAAACAACTCCAGAAAACCACAACTTTAAAGCAAAAAGCAACTTTA
TATGATGGGATAGATTTATTAACAAATGCTATTCACCCTCTTACAAATGA
ATTGATCCCTGTCTATGTTGCTAACTATGTAATTGAAGGATATGGAACAG
ATGCTATTATGGGTGTTGGAGCACACAATGAAAATGATAACTTCTTCGCA
CGTAAACAAAAGTTGAAAATTATCAACGTCATTGATAAAAAAGAACGGCT
GCAAAATTCATTTGCATATAACGGATTAACAACTAAAGAAGCACAAGTAG
CTATTACTAATGAGTTAATTTCACAAAATAAAGCGAAATTAACAACTGTA
TATAAACTGCGTGATTGGATCTTCAGTAGACAGCGTTATTGGGGCGAACC
TTTTCCAATTATTTTTGATGAAAATAACACTCCTCATTTGGTAGAACAAC
TCCCTGTTGAATTACCCTTACTTGAGAATTACAAACCAGATGGAAGTGGT
AATTCTCCACTAATGAGAAATCAAGCTTGGGTAAACATAGTCAAAGATAA
CATCCATTACCAAAGGGAAACTAATACCATGCCCCAATGAGCTGGTTCTT
GTTGGTATTATCTGGGTTATTTAATGTTGATTAAAAACCCTAATTTTTGA
CCAATTGATTCAAAAGAAGCGAAGAAATTATTTGATCAATACCTTCCAGT
TGATCTTTATGTTGGGGGTGCGGAACATGCAGTTTTACACCTTTTGTATG
CCCGTTTTTGACACAAATTTTTGTTTGACAAGAAGCTAGTATCAACAAAA
GAACCATTTCAAAAATTAATTAATCAGGGTATGGTGTTAGGTCCTGATGG
TAAAAAGATGTCCAAATCCAAAGGTAATACCATTAACCCCACACCACTTG
TTGATTCACATGGAGCAGATGCTTTAAGGTTGTACTTAATGTTTATGGGC
CCAATTAGTGCTAGTTTAACTTGAAATGATGAAGGGTTAAACGGGATGAG
AAGGTGATTGGATCGAGTTTATAACTTCTTTTTTAATCATGCTGTTGTTA
CTGATCAAGTTAGTCAAGAGACAATCTTTGCTTACAATTTGTTTTTAAAA
AACAGTTATTGTCATCTTGACAAACATGAACTAAATCTGGTGATTAGTGA
AATGATGATCTTTTTAAACTTTCTCTATAAAACCAAAAAAATTAGCTTAA
ATTATGCAAAGGGATTTTTAACAGTACTGTCGTTTTTTGCGCCCTTTCTT
GCTGAAGAATTGAATGAAAAATGTGGACTTGAACCATTTGTTGTTAAACA
AGCGATTTCTTTAGTTGATTATCAACTTTTTGAGACTGCTAAAACTAAGG
TTATTCTTTCAATTAATGGCAAATTTAAAGCAGCTAAAGAATTTACTAAA
GGTAGTTTAGAGATAGATGTTTTAGAATCATTTAAACAGGATAAAGAGAT
AAATGACATTCTCAACCAACCGATTGAGAGGGTAGTTTATGTTCAGGATC
GAATTATTAATGTTCTTTTAAAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy