Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR191 IGR193 IGR190 MG265 leuS, - MG266 fpg, - MG262.1 MG263 MG262 polC-2,dnaE_3, - MG261 MG265 leuS, - MG266 fpg, - MG262.1 MG263 MG262 polC-2,dnaE_3, - MG261 Type: inverted, Name:  - 50 Type: inverted, Name:  - 50 MG265 leuS, - MG266 fpg, - MG262.1 MG263 MG262 polC-2,dnaE_3, - MG261 MG264 MG264
* Calculated from Protein Sequence

Gene ID: MG262.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fpg  

Definition:
formamidoprymidine-DNA glycosylase

Gene Start:
319205

Gene Stop:
320056

Gene Length:
852

Molecular Weight*:
32735

pI*:
0.00

Net Charge*:
0.00

EC:
3.2.2.23  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, andrepair  

Pathway: pathway table

Comment:
This record is not in the original genbank record.

See Prosite PDOC00956.

From Prosite:

Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase)(gene fpg) is a bacterial enzyme involved in DNA repair and which excise oxidized purine bases to release 2,6-diamino-4-hydroxy-5N-methylformamido-pyrimidine (Fapy) and 7,8-dihydro-8-oxoguanine (8-OxoG) residues. In addition to its glycosylase activity, FPG can also nick DNA at apurinic/apyrimidinic sites (AP sites). FPG is a monomeric protein of about 32 Kd which binds and require zinc for its activity.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to formamidoprymidine-DNA glycosylase sequences; e.g. residues 1-272 are 66% similar to FPG_MYCPN; residues 1-272 are 37% similar to FPG_BACFI; residues 1-273 are 38% similar to FPG_STRMU; and residues 1-273 are 37% similar to FPG_LACLC. Residues 1-272 are 47% similar to residues 1-274 of UU413, a predicted formamidopyrimidine-DNA glycosylase. Also significant similarity to: FPG_HAEIN, FPG_NEIME, FPG_SYNY3, FPG_ECOLI, and FPG_MYCTU.
No significant similarity to C.trachomatis, C.pneumoniae, or T.pallidum.

COGS Summary:  COGS Search
Automatic COG was not run. Manual search reveals similarity to COG0266 (Formamidopyrimidine-DNA glycosylase) with BeTs to g,h,and c

Blocks Summary:  Blocks Search
Residues 1-272 span seven regions of similarity to blocks BL01242A-G (Formamidopyrimidine-DNA glycosylase proteins) with a combined E-value of 1.3e-70.

ProDom Summary:  Protein Domain Search
Only hits seem to be to this same sequence ProDom database.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 121 (E-value = 5.2e-60) place MG262.1 in the Fapy_DNA_glyco family which is described as Formamidopyrimidine-DNA glycosylase N-terminal domain (PF01149)
Residues 133 to 225 (E-value = 5.9e-48) place MG262.1 in the H2TH family which is described as Formamidopyrimidine-DNA glycosylase H2TH domain (PF06831)

PDB Hit:


Gene Protein Sequence:
MPELPEVTTVINELKETVLNKPLDQVQVNLRKVLKNIDPQLLNKQLKNQF
FTDIKRKGKYIIFLLSNGLYLVSHLRMEGKYFFEERGSKFNQKHVLVEFH
FDDGSQLNYHDTRQFGTFHLYEKLEQAAQLNKLAFDPLEAGFDYRKIFQK
AQNSKRKVKTFILDQTVISGIGNIYADEILFASKINPETMVDQLTIKEIE
ILCKNATKILAKAIVMKGTTISSFSFKKDHTGGYQNFLKVHTKKDQPCSV
CNQLIVKKKINGRGSYFCLNCQKITTKVSTKLNP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTGAACTTCCTGAAGTAACTACTGTTATTAATGAACTTAAAGAAAC
TGTTTTAAATAAACCTTTAGATCAAGTTCAAGTTAACCTAAGAAAGGTTT
TGAAAAATATTGATCCTCAATTGCTGAATAAACAATTAAAAAATCAGTTT
TTTACTGATATTAAGCGTAAGGGTAAATATATCATTTTTCTTTTAAGTAA
TGGTTTGTATTTAGTTTCGCATTTACGTATGGAAGGTAAATACTTTTTTG
AAGAAAGAGGTAGTAAATTTAATCAAAAGCATGTTTTAGTAGAATTTCAT
TTTGATGATGGTAGTCAACTCAATTATCATGACACCAGACAATTTGGAAC
GTTCCATTTGTATGAAAAGTTAGAACAAGCAGCACAATTAAATAAACTTG
CATTTGATCCTCTAGAAGCTGGTTTTGACTATAGGAAAATCTTCCAAAAA
GCACAAAATTCAAAACGTAAAGTTAAAACTTTTATTTTAGACCAAACAGT
GATTAGTGGAATTGGCAATATTTATGCAGATGAAATCTTATTTGCAAGCA
AAATTAATCCTGAAACAATGGTTGATCAACTAACAATTAAAGAGATAGAG
ATTTTATGTAAAAATGCTACCAAAATTTTAGCTAAAGCAATAGTTATGAA
AGGTACTACCATCAGCAGCTTTAGTTTTAAAAAAGATCATACTGGAGGCT
ATCAAAACTTTTTAAAAGTTCACACTAAAAAAGATCAACCTTGCTCAGTT
TGTAACCAATTAATTGTTAAAAAGAAGATTAATGGAAGGGGGAGCTATTT
TTGTTTAAACTGTCAAAAAATCACAACCAAAGTTTCTACAAAACTCAATC
CA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy