Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-3 IGR191 IGR190 MG265 fpg, - MG262.1 MG263 MG262 MG260 polC-2,dnaE_3, - MG261 MG265 fpg, - MG262.1 MG263 MG262 MG260 polC-2,dnaE_3, - MG261 Type: inverted, Name:  - 50 Type: inverted, Name:  - 50 MG265 fpg, - MG262.1 MG263 MG262 MG260 polC-2,dnaE_3, - MG261 MG264 MG264
* Calculated from Protein Sequence

Gene ID: MG261

DNA Molecule Name:
1  

Genbank ID:
1045954

Gene Name:
polC-2  dnaE_3  

Definition:
DNA polymerase III alpha subunit (polC2)

Gene Start:
315699

Gene Stop:
318320

Gene Length:
2622

Molecular Weight*:
100430

pI*:
8.60

Net Charge*:
9.28

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Primary Evidence:
Koonin EV, Bork P. 1996. Ancient duplication of DNA polymerase inferred from analysis of complete bacterial genomes. Trends Biochem Sci 21(4):128-9. Medline: 8701468.

Barnes MH, Tarantino PM Jr, Spacciapoli P, Brown NC, Yu H, Dybvig K. 1994. DNA polymerase III of Mycoplasma pulmonis: isolation and characterization of the enzyme and its structural gene, polC. Mol
Microbiol 13(5):843-54. Medline: 7815943.

Secondary Evidence:
Kim DR, Pritchard AE, McHenry CS. 1997. Localization of the active site of the alpha subunit of the Escherichia coli DNA polymerase III holoenzyme. J Bacteriol 179(21):6721-8. Medline: 9352922.

Pacitti DF, Barnes MH, Li DH, Brown NC. 1995. Characterization and
overexpression of the gene encoding Staphylococcus aureus DNA polymerase III. Gene 165(1):51-6. Medline: 7489915.

Comment:
PolIII is a multichain enzyme with replicative function as well as 3' to 5' exonucleolytic activity. For other polIII subunits, see MG001, MG007, MG031, MG420. MG031 is more similar to polC of Gram-positives whereas MG261 is more similar to Gram-negatives : MG031 possesses an exonuclease domain whereas MG261 does not.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to polIII alpha subunit sequences, e.g. residues 1-867 are 56% similar to DP32_MYCPN. Residues 2-786 are 29% similar to DP3A_HELPY. MG261 is similar to T.pallidum TP0669, a polIII alpha sequence: residues 276-836 are 34% similar to this sequence. Residues 276-873 are 33% similar to CT545, the trachomatis polIII alpha sequence.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0587 is ehGPC--u.
COG name: DNA-dependent DNA polymerase III alpha chain.
Functional Class: L
BeTs to -hg-c--u.
Number of proteins in this genome belonging to this COG is 2.


Blocks Summary:  Blocks Search
Residues 842-855 are matched to block PR00379A (intein signature), e.g.
DPOL_THELI.

ProDom Summary:  Protein Domain Search
Residues 2-342, 148-177, 343-798 constitute defined domains of DP32_MYCGE and DP32_MYCPN. Residues
336-582 are 25% similar to a domain of DP3A_MYCGE. Residues 164-303 are 27% similar to a domain
of YCF2_MARPO. Residues 620-704 are 25% similar to a domain of DP3A_HAEIN.


Paralogs:  Local Blast Search
MG261 is paralogously related to MG031, also a polIII alpha subunit sequence: residues 790-1307 of MG031 are 20% similar to residues 203-726 of MG261.

Pfam Summary:  Pfam Search
Residues 3 to 67 (E-value = 5.5e-24) place MG261 in the PHP_N family which is described as PHP domain N-terminal region (PF02231)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
214  
245
coil-coil  
258  
290

PDB Hit:


Gene Protein Sequence:
MFVNLHTNSYYNFLNSALSPKKLVNLAINDQQKAVAITDPNLFGAVEFFI
TCKQNNIKPIIGLNLTVEYQKNDVKLLLIAKSNKGFQTLNKIALIQQKLE
INSLVDQLTDIAVIICSLTTWKSTYKDVYQAKGIEINQTPIAILANAVNC
EKTNSDQVVLTVLKQMKQNQTGKITTFDWDLKQKLNQISINENLKVKSEI
QPFLDQKTAQQLFSETELNNLNDLVNRCELDLEHLKAASLSLTDNDAAVL
ESLCQTNLKQFLDKNQDLNKKAYQLRLEKELNVINKLNFASYFLVVNDLV
NYAFKKDILIGSGRGSAVGSLVAFLLNITKIDPVQHQLIFERFISTHRQD
LPDIDIDIMENKRAEMINYLFEKYGKENCAQIVTFQRFKTRSAVKEVAKL
FNDYGISDMILGVLPKDQTITFTDLKATEDSALQLCLQQFGLIVELALAI
VDFPRQSSIHASGIVIASNSLIKTIPLLQLDNNHFLTQVSMEWLSFFNLN
KFDLLGLINLTMISDVITQIKPSNQTVNQFLNTISWTDQNTFINLVNEDT
LGIFQLESFGMKKLLVQIKPKTINQLAIVLALYRPGAQDNINLFINRLHN
GYDQSDIDPRILPIVKNTYGVLIFQEQIINIVKVVANYSLEEADSFRRAI
SKKDVKLIQKNKRNFFERAVQNNFDLKTTTKIFSYIERFANYGFNLSHAL
GYALLSYWTAWLKTNYPVYFYLWLLNHFQSSKDKQKLIIRTLEKSGIEIY
PPLLNKAQPNSVIENKKIYLGLNLIKGINDRYIQNLQKVQHLIQTQNNLQ
LTDVVSWCLDKTIGDIPLKDLLLLKTMGCFDFFEYTYDFNDAKDFWIKSD
HLLFTRMPLEKKDSNFWIKQFFTN

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTGTTAATTTACATACAAATTCATACTATAACTTTCTCAATTCTGC
CCTTTCTCCTAAAAAGCTAGTTAATCTAGCAATTAATGATCAGCAAAAAG
CTGTTGCTATTACAGATCCTAATCTTTTTGGCGCTGTTGAATTTTTTATA
ACTTGTAAGCAAAATAATATTAAACCAATTATTGGTTTAAACTTAACTGT
TGAATACCAAAAAAATGATGTTAAGTTATTACTAATTGCTAAATCAAATA
AAGGCTTTCAAACGTTGAACAAAATAGCATTAATTCAACAAAAACTTGAA
ATTAATTCTTTAGTTGATCAACTAACAGATATTGCAGTAATTATCTGTTC
TTTAACAACATGAAAATCTACTTATAAGGATGTTTATCAAGCAAAAGGAA
TTGAAATAAATCAAACCCCGATTGCCATTCTTGCAAATGCTGTTAACTGT
GAAAAAACTAATAGCGATCAAGTAGTTTTAACAGTTTTGAAACAAATGAA
ACAAAACCAAACGGGAAAAATAACTACATTTGATTGGGATCTTAAACAAA
AATTAAATCAAATTTCAATTAATGAAAATTTAAAAGTAAAGAGTGAAATT
CAACCTTTTTTAGATCAAAAAACTGCACAACAATTATTCAGTGAAACAGA
ACTTAATAATCTGAATGATCTAGTTAATAGATGTGAATTAGATTTGGAGC
ACCTAAAAGCTGCTTCACTTTCTTTAACTGATAATGATGCAGCAGTTTTA
GAAAGTTTGTGCCAAACCAATTTAAAACAGTTTTTAGATAAAAATCAAGA
TCTAAATAAAAAAGCCTATCAGCTACGTTTAGAGAAGGAATTAAATGTTA
TCAATAAACTTAATTTTGCTAGCTATTTTTTAGTTGTCAATGATCTTGTT
AATTATGCTTTTAAAAAGGACATCTTAATTGGTTCTGGTAGAGGTTCTGC
AGTAGGATCATTAGTGGCTTTTTTATTAAACATTACCAAGATAGACCCAG
TCCAACACCAGCTTATTTTCGAACGTTTTATCTCAACCCACCGTCAAGAT
CTACCTGATATTGATATTGATATCATGGAGAATAAAAGAGCAGAAATGAT
AAATTATCTGTTTGAAAAATATGGCAAAGAAAACTGTGCACAAATTGTTA
CTTTTCAACGTTTTAAAACCCGTTCTGCTGTTAAAGAAGTTGCTAAATTA
TTTAATGATTATGGCATTAGTGACATGATCCTAGGAGTGTTACCTAAAGA
TCAAACTATAACATTCACTGATCTTAAAGCTACTGAAGATAGTGCTTTAC
AACTTTGTTTACAACAGTTTGGTTTAATTGTTGAATTAGCACTAGCAATA
GTTGATTTTCCAAGACAATCAAGTATCCATGCTTCAGGCATAGTTATCGC
TTCAAATTCTTTGATTAAAACCATTCCCTTGTTACAGCTTGACAATAATC
ACTTTTTAACTCAAGTTTCAATGGAATGGTTAAGTTTTTTTAATCTCAAT
AAGTTTGATCTGCTTGGTTTAATTAACCTTACTATGATTAGCGATGTAAT
TACCCAAATTAAACCATCTAACCAGACCGTTAACCAGTTTTTAAATACCA
TTTCTTGAACTGATCAAAACACCTTTATAAACTTAGTAAATGAAGATACA
CTAGGAATCTTTCAACTTGAATCGTTTGGCATGAAAAAATTACTGGTTCA
GATTAAACCTAAAACCATTAATCAACTAGCAATTGTTCTAGCGCTTTACA
GACCAGGTGCACAGGATAACATTAACCTTTTTATTAACCGCTTGCACAAT
GGTTATGATCAATCTGACATTGATCCTAGGATTTTACCCATTGTGAAAAA
TACCTATGGAGTTTTAATTTTTCAAGAGCAGATCATTAACATCGTTAAAG
TTGTGGCTAACTACTCTTTAGAAGAAGCAGATAGCTTCCGTAGAGCCATT
TCTAAAAAGGATGTTAAATTGATCCAAAAAAATAAGCGTAACTTCTTTGA
AAGAGCAGTTCAAAATAACTTTGATTTAAAGACTACTACCAAAATTTTTA
GCTACATAGAACGCTTTGCTAACTATGGGTTTAACCTTTCTCATGCGTTG
GGTTATGCACTGCTTTCATACTGAACAGCTTGACTTAAAACTAACTATCC
TGTTTATTTTTATTTATGGTTATTAAACCATTTTCAATCTAGTAAAGACA
AACAAAAACTAATTATTAGAACTTTAGAAAAAAGTGGTATTGAAATTTAT
CCACCTCTTTTAAATAAAGCTCAACCAAATAGTGTTATAGAAAATAAAAA
AATTTATTTAGGTCTAAACCTAATTAAGGGAATTAATGACAGGTACATCC
AAAACTTACAAAAAGTGCAACATTTAATTCAAACTCAAAATAACTTACAA
CTAACTGATGTAGTAAGTTGGTGTTTGGATAAAACCATTGGTGATATCCC
TTTAAAAGATTTACTTTTATTAAAAACTATGGGCTGTTTTGATTTTTTTG
AATACACTTATGACTTTAATGATGCAAAGGATTTTTGAATTAAAAGCGAT
CACCTATTGTTTACCAGAATGCCTTTAGAAAAAAAGGATAGTAATTTTTG
AATTAAACAATTTTTTACCAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy