Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Trp-1 tRNA-Gly-1 tRNA-Arg-2 IGR187 IGR188 IGR186 IGR189 IGR184 IGR190 lig, - MG254 rpL31, - MG257 MG255.1 MG256 rf1,prfA, - MG258 MG255 hemK, - MG259 MG260 lig, - MG254 rpL31, - MG257 MG255.1 MG256 rf1,prfA, - MG258 MG255 hemK, - MG259 MG260 lig, - MG254 rpL31, - MG257 MG255.1 MG256 rf1,prfA, - MG258 MG255 hemK, - MG259 MG260
* Calculated from Protein Sequence

Gene ID: MG259

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemK  

Definition:
protoporphyrinogen oxidase homolog

Gene Start:
309008

Gene Stop:
310375

Gene Length:
1368

Molecular Weight*:
52797

pI*:
10.63

Net Charge*:
40.06

EC:
1.3.3.4  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme and porphyrin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical proteins, protoporphyrinogen oxidases, and to methyltransferases,
e.g. residues 1-454 are 53% similar to Y259_MYCPN. Residues 50-247 are 27%
similar to HEMK_HAEIN. Residues 66-187 are weakly similar to CT024, a predicted DNA metylase in C.trachomatis.
MG259 is very weakly similar to TP0052, protoporphyrinogen oxidase from T.pallidum
(E value 0.002). It is more similar to the enzyme from B.burgdorferi (AE001130).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0500 is ehgpcmy.
COG name: SAM-dependent methyltransferases.
Functional Class: R
BeTs to h,g,c,m,y.


Blocks Summary:  Blocks Search
Residues 95-127, 135-161, 178-187 are matched to blocks BL01261A-C, concerned with
uncharacterized proteins, e.g. YCBY_HAEIN, Y710_METJA. Residues 178-186
are similar to block BL00092 (N-6 adenine-specific DNA methylases. Residues
342-355 match block BL01147B (SUA5/ycio/yrdC family). Residues 112-124
are similar to block BL01230A (RNA methyltransferases).

ProDom Summary:  Protein Domain Search
Residues 83-367 constitute a defined domain of Y259_MYCGE. Residues 96-189
are 34% similar to a domain of YFIC_HAEIN. Residues 98-183 are 33% similar to a domain of
PRMA_HELPY.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
288

PDB Hit:


Gene Protein Sequence:
MTLYEFFLNQKLVYQSSPHFNGVFLTILEHYGFQFKTIDKLWKSKLLITS
ELTDKIKQQLKCYFIEKIPLPYLLGTIQLRKLTFKTKKGVFIPRIDSLAL
IASVNLKKIKTALDLCCGSGTLAIALKKKCDTLDVYGSDIDIQALKLAQQ
NALINNVSINWIEADWFDCFNKIKTPIDLIVTNPPYLKKTQLNKTLNYEP
KHSLVFQNKNSYFAYKQLFNLLLTKRSIKQLIFECSLFQKERLLNLFSIF
KSRPIFNFQKQFIGMKVDNQKLPVVDIKNTKTIKQLLKMGLAGIVNTDTQ
MGLISYSESTLDKIKQRALNKHYVSMFGLEELKKLPKKLQQIASYFWPGS
YTFIKNNKSYRVPKNLGLLNLFNAIGRVFCTSANISNQKPYTKLSDYQND
SYWIKQPCFIIRSTSKVQSNNTPSLVYNLDTKQLVRTTAKQTKQFHKLIT
KHQLAI

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCTGTATGAGTTTTTTTTAAATCAAAAGTTAGTTTACCAATCCAG
TCCCCATTTTAACGGGGTATTTTTAACAATATTGGAACACTATGGTTTTC
AATTTAAAACAATTGATAAACTCTGAAAAAGTAAGCTTCTAATTACTAGT
GAGTTAACTGATAAAATCAAACAACAATTAAAGTGTTATTTTATTGAAAA
GATCCCTTTGCCCTATTTGTTGGGAACAATTCAACTAAGGAAGCTTACTT
TTAAAACTAAGAAAGGAGTTTTTATTCCTCGAATTGATAGCTTAGCACTA
ATTGCAAGTGTTAACTTAAAAAAAATAAAAACTGCACTTGACCTTTGTTG
TGGTTCAGGTACTTTAGCCATTGCTTTAAAAAAGAAGTGTGATACACTTG
ATGTTTATGGTAGTGATATTGATATCCAAGCATTAAAACTAGCGCAACAA
AATGCATTAATTAATAACGTTAGTATTAATTGAATTGAAGCAGATTGATT
TGATTGTTTTAACAAGATAAAAACTCCGATTGATTTAATTGTTACAAACC
CACCTTATCTGAAAAAAACACAACTAAATAAAACATTAAATTATGAGCCT
AAGCACAGCTTGGTTTTTCAAAATAAAAATAGTTATTTTGCATACAAGCA
GTTGTTTAATCTATTACTAACAAAACGATCAATTAAACAGTTAATTTTTG
AATGTTCTTTATTTCAAAAAGAAAGGCTATTAAATTTGTTTTCAATCTTT
AAATCAAGGCCGATTTTTAACTTTCAAAAACAGTTTATTGGTATGAAAGT
TGATAATCAAAAACTCCCAGTAGTTGATATTAAAAATACCAAAACTATTA
AGCAACTTTTAAAAATGGGGCTAGCAGGAATTGTAAATACTGATACACAA
ATGGGATTAATTAGTTATTCAGAGTCTACTCTTGACAAAATTAAACAACG
TGCACTTAACAAACATTATGTATCAATGTTTGGGTTAGAAGAATTAAAGA
AGTTACCAAAAAAACTACAACAAATTGCTAGTTACTTTTGACCAGGTAGT
TATACCTTTATTAAAAATAACAAGAGCTACAGGGTTCCTAAAAACTTGGG
CTTATTAAACCTTTTTAATGCAATTGGTAGGGTTTTTTGTACTAGTGCTA
ATATCAGTAATCAAAAACCATACACCAAATTAAGTGATTATCAAAACGAT
AGTTACTGAATAAAGCAACCTTGTTTTATTATTAGAAGCACTTCTAAAGT
GCAATCAAATAACACACCTTCACTTGTCTATAATTTAGATACAAAACAGT
TGGTTCGCACCACAGCTAAACAAACAAAACAGTTTCATAAATTAATAACT
AAACACCAGTTAGCTATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy