Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Trp-1 tRNA-Gly-1 tRNA-Arg-2 IGR182 IGR183 IGR181 IGR180 IGR184 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG255.1 MG256 MG255 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG255.1 MG256 MG255 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 glyS, - MG251 glyS, - MG251 MG256 MG255 MG255.1
* Calculated from Protein Sequence

Gene ID: MG253

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cysS  

Definition:
cysteinyl-tRNA synthetase

Gene Start:
302839

Gene Stop:
301556

Gene Length:
1284

Molecular Weight*:
49894

pI*:
10.22

Net Charge*:
19.95

EC:
6.1.1.16  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Cysteine metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
From Prosite:

Aminoacyl-tRNA synthetases (EC 6.1.1.-) are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid.

Reference:

Authors: Eriani,G., Dirheimer,G. and Gangloff,J. Title: Cysteinyl-tRNA synthetase: determination of the last E. coli aminoacyl-tRNA synthetase primary structure. Journal: Nucleic Acids Res. 19 (2), 265-269 (1991).


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to cys-tRNA synthetase sequences, e.g. residues 2-428
are 69% similar to SYC_MYCPN. Residues 13-422 are 31% similar to SYC_BACSU.
Residues 18-253 are 32% similar to TP0091, a predicted cys-tRNA synthetase in
T.pallidum. MG253 is also similar to CT782, the predicted cys-tRNA synthetase from
C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0215 is ehgpc-y.
COG name: Cysteinyl-tRNA synthetase.
Functional Class: J
BeTs to h,g,c,y.


Blocks Summary:  Blocks Search
Residues 19-27 are matched to block PR00410F, concerned with phenol hydrolase
sequences, e.g. XYLZ_PSEPU. Residues 25-35, 236-246, 251-260 are members of
blocks BL00178A,B, concerned with amino acyl tRNA synthetases.

ProDom Summary:  Protein Domain Search
Residues 13-31, 32-139, 163-208, 221-236, 268-292, 322-428 constitute defined
domains of SYC_MYCGE.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 9 to 301 (E-value = 2.8e-188) place MG253 in the tRNA-synt_1e family which is described as tRNA synthetases class I (C) catalytic domain (PF01406)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
146

PDB Hit:


Gene Protein Sequence:
MIVDSVSQKPTTLVQKTINIYLCGPTVYNDLHLGNTRPLIVFDVLNRVLK
KAKYTVNFVQNITDIDDKIIKIAQQQEVSESVVTKQQITAYKSLLKKLNI
LPIKHIQITEKIDKIPDYIDQLVNQNHAYVSTQNNVYFAVNSLKQYGYLA
NRMVHLEETDTDKKNKLDFVLWKITTAGIKWNSKWGLGRPGWHVECAFLI
DYCFKNELTIHGGGVDLKFPHHENENALHMALYNQPITKHWMHIGHLMIE
NQKMSKSLQNFLLAVDFLNFHDFRVLRWIFYQKHYLHPIDLNQSLIEKAN
NDIQRIAKTLNVARTWLVYSEQSELISPKQYDPVFSALLDNLNFANAVAA
IWKLIKKINTSIKTKDFSVLREQLSFLEWSIDLLGISFKSIHTKLNVRLI
KEWSILHKQKAMDKADQIRKKLIKKMLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGTTGACAGTGTTAGTCAAAAACCAACAACACTAGTTCAAAAAAC
CATTAACATTTATCTCTGTGGACCCACAGTTTATAACGATTTGCACTTAG
GCAACACCAGACCATTAATTGTTTTTGATGTTTTAAATAGAGTTTTAAAA
AAGGCTAAATATACCGTTAATTTTGTTCAAAACATCACTGATATTGACGA
TAAGATCATCAAGATTGCTCAACAACAAGAAGTAAGCGAATCAGTTGTTA
CAAAACAACAAATCACTGCTTACAAATCACTTTTAAAAAAACTAAATATT
CTGCCTATTAAACATATTCAAATCACTGAAAAAATCGATAAAATCCCTGA
CTATATTGATCAATTAGTAAATCAAAACCATGCTTATGTTTCAACTCAAA
ACAACGTTTATTTTGCAGTTAATTCACTAAAGCAATATGGTTATCTAGCT
AACCGAATGGTGCATTTAGAAGAAACTGATACTGATAAAAAGAACAAATT
GGATTTTGTACTTTGAAAGATTACTACTGCAGGGATTAAATGAAATAGTA
AGTGGGGACTTGGCAGACCAGGTTGACATGTTGAATGTGCCTTCTTAATT
GATTATTGTTTCAAAAATGAACTCACGATCCACGGAGGAGGAGTTGATTT
AAAGTTCCCCCACCATGAAAATGAAAATGCCTTACACATGGCTTTATATA
ACCAGCCCATTACCAAACATTGGATGCATATTGGTCATTTGATGATTGAA
AACCAAAAGATGTCAAAGTCATTGCAGAACTTCTTGTTAGCAGTTGATTT
TCTTAACTTTCATGATTTTCGTGTTTTGCGTTGGATCTTTTACCAAAAAC
ACTATTTGCATCCTATTGATCTAAACCAATCATTGATTGAAAAAGCTAAT
AATGATATTCAAAGGATTGCAAAAACACTTAATGTTGCTAGAACCTGATT
AGTTTATTCAGAACAATCTGAGTTGATTAGTCCCAAGCAATATGATCCAG
TTTTTTCAGCTTTACTTGATAATCTCAACTTTGCCAATGCAGTTGCTGCT
ATCTGAAAACTAATAAAAAAAATTAATACAAGTATTAAAACTAAGGACTT
TAGTGTGCTGAGAGAACAACTTAGTTTCTTGGAATGATCAATTGATTTAT
TAGGAATTAGCTTTAAATCTATCCATACTAAACTTAATGTGCGTTTAATT
AAAGAGTGATCAATATTACACAAACAAAAAGCAATGGATAAAGCTGATCA
AATTAGAAAAAAACTAATTAAAAAAATGTTGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy