Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 IGR182 IGR183 IGR181 IGR180 IGR184 MG247 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG255 MG247 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG255 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG248 glyS, - MG251 glyS, - MG251 MG247 MG248 MG255
* Calculated from Protein Sequence

Gene ID: MG251

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glyS  

Definition:
glycyl-tRNA synthetase

Gene Start:
300802

Gene Stop:
299465

Gene Length:
1338

Molecular Weight*:
52283

pI*:
8.13

Net Charge*:
4.63

EC:
6.1.1.14  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Glycine, serine and threonine metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00363.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to gly-tRNA synthetases, e.g. residues 1-444 are
70% similar to SYG-MYCPN. Residues 8-440 are 37% similar to the glyS protein of M.tuberculosis
(Z95208). Residues 8-433 are 36% similar to the gly-tRNA synthetase of T.pallidum, TP0672.
MG251 is weakly similar to CT581, a predicted thr-tRNA synthetase;
curiously there is no similarity to CT796, a predicted gly-tRNA synthetase.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0423 is --gp-my.
COG name: Glycyl-tRNA synthetase.
Functional Class: J
BeTs to g,m,y.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 14-176, 177-214, 215-306, 307-438 constitute defined domains of
SYG_MYCGE. Residues 191-232 are 27% similar to a domain of SYG_BOMMO.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 32 to 242 (E-value = 3.3e-62) place MG251 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 355 to 444 (E-value = 2.2e-24) place MG251 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

PDB Hit:
gi|2392169|pdb|1ATI|A Chain A, Crystal Structure Of Glycyl-Trna Synthetase From Thermus Thermophilus Protein Biosynthesis, Ligase, Synthetase, Aminoacyl-Trna Synthetase Mol_id: 1; Molecule: Glycyl-Trna Synthetase; Chain: A, B; Synonym: Glycine-Trna Ligase

Gene Protein Sequence:
MAKVYNQEVYVQFLKQHGFVFQSSEIYNGLNNSWDFGPLGAVLKQQIKQA
LYNFFIKNKADVLLVETPIILSELVWKASGHLANFVDTLVDCKSCKYRFR
VDQINAEIKAKKDWNSFKVNCPNCHNQNWSEVRDFNLLFQTEIGVVNNDK
RLVFLRPETAQGSFINFKNILQAKKRNLPFAIAQFGKSFRNEITPGNFLF
RTREFEQFEIEWFCKPDDANSLFEKQLIMVEQFLQTVLKINPELLKKHEY
DQSELAHYAKKTTDFLFNFPHGLKELWGLANRGDFDLKQHQEFSKKSMSF
FDSELNQHFLPFIIEPAVGIERLFYALIVSSYRREIINEEEREVLSLPFD
LCPEQIIVLPLVNKLKKEAFSVFETLAKTRWRVCFETTGSIGKRYRKADA
IGIKYAVTFDFESLEDNAVTIRDRDTLVQQRIAIKELPQWFMKNGQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAGTTTACAACCAAGAAGTTTATGTTCAGTTTCTCAAACAACA
TGGTTTTGTATTTCAGAGTAGTGAAATTTACAACGGTTTAAACAATAGTT
GGGATTTTGGTCCATTAGGTGCAGTTTTAAAACAACAAATCAAACAAGCT
TTATATAACTTTTTTATTAAAAATAAAGCTGATGTTCTTTTAGTTGAAAC
CCCTATTATTCTCAGCGAATTGGTTTGAAAAGCATCAGGACATTTAGCTA
ACTTTGTTGATACTTTAGTTGATTGTAAGAGTTGTAAATACCGCTTTCGT
GTTGATCAAATTAATGCTGAAATAAAAGCTAAAAAGGATTGGAATAGTTT
TAAAGTTAACTGTCCTAATTGTCATAACCAAAATTGATCAGAAGTGAGGG
ATTTTAACTTACTTTTTCAAACTGAAATCGGGGTTGTAAACAACGATAAA
CGCCTTGTTTTTCTCCGTCCTGAGACTGCTCAAGGTAGCTTTATTAACTT
TAAAAATATCTTGCAAGCTAAGAAGCGTAATTTACCTTTTGCTATTGCCC
AGTTTGGTAAAAGCTTTCGTAATGAAATCACCCCAGGTAACTTCTTGTTT
AGAACTAGAGAGTTTGAACAGTTTGAAATTGAGTGGTTTTGTAAACCTGA
TGATGCAAATTCGCTGTTTGAAAAACAATTAATAATGGTAGAACAGTTTC
TACAAACAGTGTTAAAAATTAACCCAGAATTGTTAAAAAAACATGAATAT
GATCAATCAGAATTGGCTCATTATGCCAAAAAAACTACTGACTTTTTGTT
TAATTTTCCCCACGGATTAAAGGAGTTATGAGGCTTGGCTAACAGGGGTG
ATTTTGATCTAAAACAACACCAAGAGTTTTCAAAAAAGAGCATGAGTTTT
TTTGATAGCGAATTAAACCAACATTTCTTACCTTTCATAATCGAACCTGC
GGTTGGCATTGAACGGTTATTTTATGCACTAATTGTCAGTAGTTATAGGA
GAGAAATTATTAATGAGGAAGAACGGGAAGTATTGAGTTTACCATTTGAC
TTATGTCCTGAACAAATTATTGTTTTACCACTTGTAAATAAACTTAAAAA
AGAAGCATTTTCTGTATTTGAAACGCTAGCAAAAACAAGGTGAAGAGTGT
GCTTTGAGACAACTGGTAGTATTGGTAAAAGGTATCGAAAAGCAGATGCA
ATTGGAATAAAGTATGCAGTCACTTTTGACTTTGAAAGTTTAGAAGATAA
TGCAGTTACCATCAGAGATAGAGATACTTTAGTTCAACAGCGAATTGCTA
TCAAAGAATTACCACAATGATTCATGAAAAATGGTCAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy