Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR182 IGR183 IGR181 IGR180 MG247 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG246 MG247 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG246 MG247 yacO,spoU, - MG252 cysS, - MG253 rpoD, - MG249 dnaE_2, - MG250 lig, - MG254 MG248 glyS, - MG251 MG248 glyS, - MG251 MG246 MG245 MG245
* Calculated from Protein Sequence

Gene ID: MG250

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaE_2  

Definition:
DNA primase

Gene Start:
299472

Gene Stop:
297652

Gene Length:
1821

Molecular Weight*:
71052

pI*:
9.21

Net Charge*:
11.85

EC:
2.7.7.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:
DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments on both template strands at replication forks during chromosomal DNA synthesis.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA primase and its homologous sequences,
e.g. residues 7-583 are 46% similar to PRIM_MYCPN.
MG010 is similar to T.pallidum TP0492, a predicted DNA primase (dnaE),
sequence.It is also similar to C.trachomatis DNA PRIMASE (DnaG)
sequence CT794.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0358 is ehgpcm-.
COG name: DNA primase (bacterial type).
Functional Class: L
BeTs to h,g,c.


Blocks Summary:  Blocks Search
Residues 441-460, 568-588 are matched to blocks PR00488B,G,
concerned with Five-lipoxygenase activating protein signatures, e.g. FLAP_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 1-25, 26-344, 345-372, 373-585 constitute defined domains of
PRIM_MYCGE.

Paralogs:  Local Blast Search
MG250 is paralogously related to MG010, thought to be a DNA primase:
residues 216-372 are 26% similar to residues 62-215 of MG010.

Pfam Summary:  Pfam Search
Residues 3 to 101 (E-value = 1.9e-50) place MG250 in the zf-CHC2 family which is described as CHC2 zinc finger (PF01807)
Residues 267 to 348 (E-value = 3.2e-21) place MG250 in the Toprim family which is described as Toprim domain (PF01751)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
579  
607

PDB Hit:


Gene Protein Sequence:
MVNKSNSLDELLKQIKITEIIQHYGVKIQTKGNSLLALCPFHDDKNPSMS
ISSSKNIFKCWACNAAGNGIAFIQKHDQLDWKTALKKAIEICGIKLENWN
SNLLTKVDPKQKRYWEINNALITYYQTRLKRETNPNGMNYLVEKRKLNKT
LIEQFQLGLAFHNEDKYLCESMERYPFINPKIKPSELYLFSKTNQQGLGF
FDFNTKKATFQNQIMIPIHDFNGNPVGFSARSVDNINKLKYKNSADHEFF
KKGELLFNFHRLNKNLNQLFIVEGYFDVFTLTNSKFEAVALMGLALNDVQ
IKAIKAHFKELQTLVLALDNDASGQNAVFSLIEKLNNNNFIVEIVQWEHN
YKDWDELYLNKGSEQVILQANKRQNLIEYLVSFFKKQQLDQRVITNKIIA
FLTKNQTILNDHSFLIFLIKNLVKLLEYSDEKTLYETVLKHKEKLVSKFD
NNRFYINTSGHAQPPQELQKTTAALVQTAFEEAVNELWKPEIFAFALIDK
RFLVELKQSHLDEVFKECNFNLFDVELFIEKARIYWSENQTANWVGFESV
LDQNYLLNNKARLLEIKDIFLDELTCYQANDFQNYLKTFQTLLKQQKQRL
KNLKLTL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTCAATAAAAGCAACAGTTTAGATGAACTTTTAAAGCAGATTAAAAT
TACTGAAATTATTCAACACTACGGGGTTAAAATCCAAACTAAGGGTAATA
GTCTACTTGCTTTATGTCCTTTTCATGATGATAAAAATCCTTCTATGTCC
ATTTCCAGTTCTAAAAACATCTTTAAGTGTTGGGCTTGTAATGCAGCTGG
CAACGGAATAGCGTTTATCCAAAAGCATGACCAGTTAGATTGAAAAACTG
CACTTAAAAAAGCAATTGAAATTTGTGGAATTAAGTTAGAAAATTGGAAC
AGTAATTTACTAACAAAAGTTGATCCAAAACAAAAACGATATTGGGAGAT
AAACAATGCTTTAATTACTTATTATCAAACCAGATTAAAAAGAGAAACAA
ACCCAAATGGGATGAATTATTTAGTTGAAAAAAGAAAGCTTAATAAAACA
TTAATTGAACAGTTTCAGCTAGGACTTGCTTTTCACAATGAAGATAAGTA
TCTATGTGAAAGTATGGAAAGATACCCCTTCATTAATCCAAAGATAAAAC
CGAGTGAATTGTATCTTTTTTCAAAAACTAACCAGCAAGGTCTTGGCTTT
TTTGACTTTAATACCAAAAAAGCTACCTTTCAAAACCAGATTATGATCCC
TATCCATGACTTTAATGGTAACCCGGTTGGTTTTTCAGCAAGAAGTGTTG
ATAACATCAACAAACTGAAATATAAAAATAGTGCTGATCACGAATTTTTT
AAAAAAGGGGAGCTGTTATTTAACTTTCACAGGTTAAATAAAAACCTCAA
TCAACTCTTTATTGTGGAAGGTTATTTTGATGTTTTTACACTAACAAACT
CCAAGTTTGAAGCTGTTGCATTAATGGGATTAGCATTAAATGATGTGCAA
ATTAAAGCCATTAAAGCTCACTTTAAGGAGTTACAAACCTTAGTTTTAGC
ACTTGATAATGATGCTAGTGGTCAAAATGCTGTGTTTAGCTTAATTGAAA
AACTTAATAACAACAATTTTATTGTGGAAATTGTTCAGTGAGAACACAAC
TATAAAGATTGGGATGAACTGTATTTAAACAAGGGTAGTGAGCAAGTTAT
ATTACAAGCAAACAAAAGACAAAATCTAATTGAATATCTTGTTAGTTTTT
TTAAAAAGCAACAACTTGATCAAAGGGTTATTACTAATAAAATCATTGCT
TTTTTAACAAAAAACCAAACAATTTTAAACGACCATAGTTTTTTAATTTT
TCTCATTAAAAATTTGGTTAAACTACTTGAATATAGTGATGAAAAAACTC
TGTATGAAACAGTTTTAAAACACAAAGAAAAACTTGTATCTAAGTTTGAT
AACAACCGTTTTTACATAAATACTTCAGGCCATGCTCAACCACCACAAGA
ATTGCAAAAAACCACTGCAGCACTAGTGCAAACAGCTTTTGAAGAAGCAG
TTAATGAGTTGTGAAAACCTGAAATCTTTGCGTTTGCTTTAATTGATAAA
CGCTTTTTGGTTGAATTAAAACAATCCCATCTAGATGAAGTTTTTAAGGA
ATGTAACTTTAATTTGTTTGATGTTGAACTTTTTATTGAAAAAGCAAGGA
TCTATTGGAGTGAAAATCAAACTGCTAACTGAGTTGGTTTTGAAAGTGTT
TTAGATCAAAATTACCTTTTAAACAATAAAGCAAGGTTATTGGAAATTAA
AGATATTTTTTTAGATGAATTAACTTGTTATCAAGCTAATGATTTTCAAA
ACTATCTAAAGACCTTTCAAACGTTATTAAAACAACAAAAGCAGCGCTTA
AAAAATTTAAAGTTAACGCTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy