Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR179 IGR178 IGR176 IGR177 MG247 rpoD, - MG249 MG243 MG246 MG241 MG242 uvrD,mutB1,pcrA, - MG244 MG247 rpoD, - MG249 MG243 MG246 MG241 MG242 uvrD,mutB1,pcrA, - MG244 MG247 rpoD, - MG249 MG248 MG248 MG243 MG246 MG241 MG242 uvrD,mutB1,pcrA, - MG244 MG245 MG245
* Calculated from Protein Sequence

Gene ID: MG244

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
uvrD  mutB1  pcrA  

Definition:
DNA helicase II

Gene Start:
291332

Gene Stop:
293440

Gene Length:
2109

Molecular Weight*:
81952

pI*:
9.26

Net Charge*:
9.99

EC:
3.6.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:
Rep helicase is a single-stranded DNA-dependent ATPase involved in DNA replication; it can initiate unwinding at a nick in the DNA. It binds the single-stranded DNA and acts in a progressive fashion along the 3' to 5' direction.

In E.Coli this helicase is also involved in postincision events of nucleotide excision repair and methyl directed mismatch repair.

UvrD has both ATPase and helicase activities. Unwinds DNA duplexes with 3' and 5' polarity with respect to the bound strand and initiates unwinding most effectively when a single-stranded region is present. Involved in the postincision events of nucleotide excision repair and methyl-directed mismatch repair.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA helicase sequences and to exodeoxyribonucleases:
residues 1-703 are 48% similar to UVRD_MYCPN. Residues 1-593 are 30% similar to TP0102, a predicted rep helicase in T.pallidum.
MG244 is also similar to CT608, a helicase from C.trachomatis as well as to
CT639, an exodeoxyribonuclease V beta chain sequence from trachomatis.
Residues 189-617 are 26% similar to the latter.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0210 is ehgpc-y.
COG name: Superfamily I DNA and RNA helicases.
Functional Class: L
BeTs to -hg-c-yu.


Blocks Summary:  Blocks Search
Residues 402-420 are matched to block PR00761B, concerned with bindin
precursor signatures, e.g. BIND_STRPU.

ProDom Summary:  Protein Domain Search
Residues 5-703 span ten domains of Y244_MYCGE.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 486 (E-value = 1.8e-159) place MG244 in the UvrD-helicase family which is described as UvrD/REP helicase (PF00580)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
112  
147
non-globular  
152  
250
non-globular  
385  
703

PDB Hit:
gi|2781090|pdb|1PJR| Structure Of Dna Helicase Dna Repair, Dna Replication, Sos Response, Helicase, Atp-Binding, Dna-Binding Mol_id: 1; Molecule: Pcra; Chain: Null; Engineered: Yes

Gene Protein Sequence:
MNEQQKQAISCGKGVNVVYSGAGTGKTTIITNRFAYLVNKEKVDPSRILA
ITFTKKAAKEMQFRILKLIDSSLAEKTNIYTFHSFCNKFLIQTLKKRFII
DDDISYFLKEFLADSKLDINLAKQIIDNFKNTFADFEINKLDQDERLISL
CEHSLLNKDEEYSTLKTQLINAFISYEKNKILNNKLDFHDLLIKTCNLLS
NDNDLLNQWSEQFQHILVDEFQDTNQIQYELIKMLVTKNKNLFLVGDNNQ
MIYRWRGAVNGIITALKHDFNVPKSNEFFINQNYRCDQNILAVANQILLK
IMAYEKQVKTEKNLLFSTLNSDKKPVYFQAESVENQANWIFNKIKALNQT
EKINFKDMAILFRKNRDITTMVELIEADGTIPLPKQKSYFNQLVKLQRVL
IAISTRTNLDIKRALQALKIWSNDLKELWKQSDKTNLFDFLKWSELNQKN
HSSKLKATGYFNLLIKLAEDQQINLLFTELFKKLKVDQTIENLLWKKLTE
FQKDKTEFSLSEFITSLALEFDSIIENSSDTINLLTVHAAKGLEFEAVFI
YGMNQGDFPLFLSQNQNDEQHLIDELKLFYVAITRAKRFLFITAVLQINN
NSIKPSSFLNYINKSEYLDIATINYVLEQDDDFFDSTKKTDYTKKLRKES
LDIIVGDLVTSRYFGKGVVVEVRDKEVLVAFKDTRYGMKWILKNHKSLTK
ALY

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGAACAACAAAAACAAGCAATTAGTTGTGGAAAAGGGGTTAATGT
TGTTTATTCTGGAGCAGGTACTGGTAAAACAACAATTATTACTAATCGCT
TTGCATACTTGGTTAATAAAGAAAAAGTTGATCCTAGCAGAATTTTAGCA
ATCACCTTTACTAAGAAAGCTGCTAAGGAGATGCAGTTTAGAATCTTGAA
ACTAATAGATAGTTCTTTAGCTGAGAAAACAAATATCTATACATTTCACA
GCTTTTGCAATAAGTTTTTAATTCAAACATTAAAAAAGCGCTTTATCATC
GATGATGATATTAGCTATTTCCTAAAGGAATTTTTAGCTGATTCAAAACT
CGATATCAACCTAGCGAAACAAATTATTGATAACTTTAAAAATACTTTTG
CTGATTTTGAAATAAATAAGTTGGATCAAGATGAAAGGTTAATTAGTTTA
TGTGAGCATTCACTTCTAAATAAAGATGAAGAATATTCCACTTTAAAAAC
CCAACTGATTAATGCATTCATTAGCTATGAAAAGAATAAGATATTAAACA
ATAAACTTGATTTTCATGATCTTTTAATTAAAACTTGTAATTTATTGAGT
AATGATAATGATTTACTTAATCAGTGGAGTGAACAGTTTCAGCATATTTT
AGTTGATGAATTTCAAGATACCAACCAAATCCAATATGAACTGATCAAGA
TGTTAGTAACTAAAAATAAAAACTTGTTTTTGGTAGGTGATAATAACCAG
ATGATTTACCGCTGAAGAGGGGCGGTAAACGGGATCATAACTGCTTTAAA
GCATGACTTTAATGTTCCGAAAAGCAATGAATTCTTTATTAATCAAAATT
ACCGTTGCGATCAGAATATTTTAGCAGTTGCTAACCAAATTCTTTTAAAA
ATTATGGCCTATGAAAAACAAGTTAAAACTGAAAAAAATCTCTTGTTTTC
AACTTTAAATTCTGATAAAAAACCTGTTTATTTTCAAGCTGAATCAGTTG
AAAATCAAGCCAATTGGATCTTCAATAAAATCAAAGCACTAAACCAAACA
GAAAAGATTAATTTTAAGGATATGGCCATCTTGTTTAGAAAGAACAGAGA
TATTACTACTATGGTTGAATTGATTGAAGCGGATGGAACAATTCCCTTAC
CTAAACAAAAGAGTTATTTTAACCAACTAGTAAAACTCCAGCGGGTTTTA
ATTGCGATTTCAACCAGAACAAATCTTGATATTAAAAGAGCTTTGCAAGC
CCTAAAAATTTGATCAAATGATTTAAAGGAATTGTGAAAACAGAGTGATA
AAACAAACCTATTTGATTTTCTTAAATGATCAGAATTAAATCAAAAAAAC
CATAGTTCAAAACTTAAAGCTACTGGTTATTTTAATCTGCTGATTAAGTT
AGCAGAGGATCAGCAAATTAACCTTTTGTTTACTGAACTGTTTAAAAAAC
TCAAAGTGGATCAAACTATTGAAAATCTGCTTTGAAAAAAACTAACTGAA
TTTCAAAAAGATAAAACTGAATTTAGCTTATCAGAGTTTATTACTAGCTT
AGCATTGGAATTTGACTCAATTATTGAAAACAGCAGTGATACAATCAATT
TGCTAACCGTTCATGCAGCAAAAGGACTTGAGTTTGAAGCTGTATTTATT
TATGGCATGAATCAAGGGGATTTTCCCTTATTTTTAAGTCAAAATCAAAA
TGACGAACAACATTTAATTGATGAATTAAAACTGTTTTATGTTGCTATCA
CAAGAGCAAAACGTTTTTTGTTTATCACTGCGGTTTTACAAATAAATAAC
AATTCTATAAAACCATCTAGTTTTTTAAATTACATCAATAAAAGTGAGTA
TTTAGACATTGCTACTATTAACTATGTATTAGAGCAGGATGATGATTTTT
TTGATTCAACTAAAAAAACAGACTATACAAAGAAACTAAGAAAAGAAAGT
TTAGACATTATAGTGGGTGATTTAGTTACTAGTAGATACTTTGGAAAAGG
AGTTGTAGTTGAAGTGAGAGACAAAGAGGTTTTAGTAGCTTTTAAAGACA
CACGCTATGGGATGAAATGGATCTTAAAAAACCATAAATCACTAACAAAA
GCTTTATAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy