Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR174 IGR176 IGR172 IGR173 IGR175 MG240 nfo, - MG235 MG237 tig, - MG238 MG241 MG242 lon, - MG239 MG240 nfo, - MG235 MG237 tig, - MG238 MG241 MG242 lon, - MG239 Type: inverted, Name:  - 49 Type: inverted, Name:  - 49 MG240 nfo, - MG235 MG237 tig, - MG238 MG241 MG242 lon, - MG239 rpL27, - MG234 MG236 MG236 rpL27, - MG234
* Calculated from Protein Sequence

Gene ID: MG239

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lon  

Definition:
ATP-dependent protease La-1 (Lon)

Gene Start:
283395

Gene Stop:
285779

Gene Length:
2385

Molecular Weight*:
89982

pI*:
7.97

Net Charge*:
3.14

EC:
3.4.21.53  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous enzymes

Comment:
A heat shock induced peptidase that typically degrades regulatory proteins.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to AT_dependent protease LA sequences, e.g. residues 1-795
are 74% similar to LON_MYCPN. Residues 9-789 are 40% similar to LON1_BACSU.
Residues 55-794 are 36% similar to TP0524, a predicted protease LA from T.pallidum.
Residues 9-794 are 32% similar to CT344, a protease LA sequence from
C.trachomatis.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0466 is ehgp--y.
COG name: ATP-dependent protease, ATPase domain.
Functional Class: O
BeTs to e,g,y.


Blocks Summary:  Blocks Search
Residues 240-787 encompass six regions with matches to blocks BL01046A-D,
concerned with ATP-dependent proteases. Residues 374-389 match block PR00364A
(disease resistance protein). Residues 138-150, 343-357, 374-389 are similar to blocks
PR00819A,B,E, concerned with CBXX/CFQX superfamily sequences, e.g. CBXC_ALCEU.
Residues 199-228 and 697-711 are matched to blocks BL00378A,G (hexokinase).
Residues 47-82 are matched to block BL01054E (transaldolase).

ProDom Summary:  Protein Domain Search
Residues 9-81, 82-223, 224-693, 698-725, 726-763, 764-789 constitute defined
domains of LON_MYCGE. Residues n196-222 are 29% similar to a domain of LON_HELPY.

Paralogs:  Local Blast Search
MG239 is weakly similar to MG355, predicted to be an ATP-dependent protease:
residues 98-468 and 349-604 are 24% and 20% similar to this protein. An even
weaker relationship exists with MG457, a predicted cell division protein.

Pfam Summary:  Pfam Search
Residues 8 to 215 (E-value = 1.3e-05) place MG239 in the LON family which is described as ATP-dependent protease La (LON) domain (PF02190)
Residues 374 to 569 (E-value = 6.6e-50) place MG239 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 592 to 794 (E-value = 1.2e-124) place MG239 in the Lon_C family which is described as Lon protease (S16) C-terminal proteolytic domain (PF05362)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
188  
235
non-globular  
238  
323
coil-coil  
333  
363

PDB Hit:


Gene Protein Sequence:
MPVTKKSQILVVRGQVIFPFVPFSLDVGRPRSRKIIKALKTLKTKRLVLV
TQKFTGEQNPEFNDIYHVGTLCEIDEIVDVPGVDSKTVDYRIKGRGLQRV
LIEKFSDADINEVSYQLLNSTVKDEANVDRFLQRIFPEKEEIEQLMEGAE
KFLELENISKTVNVPKGLKQLDIITFKLANLVPNTESIKQAILEENEIAN
RLEKIIQAGIEDLQKIQDYGRSKNKETEFDKLDSKITRKINEQLSRQQRD
FYLREKLRIIREEIGISSKKEDEVASIRKKLDENPYPEAIKKRILSELEH
YENSSSSSQESTLTKTYIDTLLNLPWWQKSKDNSDVKNLIKTLDKNHTGL
DKVKERIVEYLAVQLRTQKNKGPIMCLVGPPGVGKSSLAKSIAEALDKKF
VKISLGGVHDESEIRGHRKTYLGSMPGRILKGMTRAKVINPLFLLDEIDK
MTSSNQGYPSGALLEVLDPELNNKFSDNYVEEDYDLSKVMFIATANYIED
IPEALLDRMEIIELTSYTEQEKIEIAKNHLIKRCLEDADLNSEELKFTDE
AISYIIKFYTREAGVRQLERLIQQVVRKYIVAMQKDGIKQETIDVNAVKK
YLKKEIFDHTMRDEVSLPGIVNGMAYTPTGGDLLPIEVTHVAGKGELILT
GNLKQTMRESANVALGYVKANAERFNINPSLFKKIDINIHVPGGGIPKDG
PSAGAALVTAIISSLTGKKVDPTVAMTGEITLRGKVLVIGGVKEKTISAY
RGGVTTIFMPEKNERYLDEVPKEIVDKLNIIFVKEYSDIYNKLFS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCGTTACGAAGAAAAGTCAGATCTTAGTAGTTAGAGGTCAAGTCAT
TTTTCCTTTTGTTCCCTTTAGTTTGGATGTTGGCAGGCCCCGTTCGCGTA
AGATCATCAAAGCGCTTAAAACTCTGAAAACCAAACGTTTGGTTTTAGTA
ACCCAAAAGTTTACTGGTGAACAAAACCCTGAGTTTAATGACATCTATCA
TGTCGGTACACTCTGTGAGATTGATGAGATAGTTGATGTTCCAGGGGTTG
ATAGTAAAACAGTAGACTACCGTATTAAAGGCAGAGGTTTACAACGGGTT
TTAATTGAAAAATTCTCAGATGCAGATATTAATGAAGTTAGTTACCAATT
ACTTAACTCCACAGTTAAAGATGAAGCTAATGTTGACAGGTTCTTACAGC
GAATCTTTCCTGAAAAAGAAGAAATTGAACAGTTAATGGAAGGAGCTGAG
AAGTTTTTAGAACTTGAAAACATCAGCAAAACAGTTAATGTTCCTAAGGG
TTTAAAGCAACTTGATATTATCACCTTTAAACTGGCTAATCTTGTCCCTA
ACACTGAAAGTATTAAACAAGCTATCTTAGAGGAAAATGAGATAGCAAAC
CGATTGGAAAAGATTATCCAAGCAGGGATTGAAGATTTACAGAAGATCCA
AGATTATGGTAGATCTAAAAACAAGGAAACTGAGTTTGATAAACTTGACA
GTAAAATTACCCGCAAAATTAACGAACAACTCTCAAGACAACAACGTGAT
TTCTATCTTCGTGAAAAGCTAAGAATTATCCGTGAAGAGATAGGGATTAG
TTCCAAAAAAGAGGATGAAGTTGCTAGTATTAGAAAGAAACTGGATGAAA
ACCCTTACCCTGAAGCCATTAAAAAACGGATTTTAAGTGAACTTGAACAC
TATGAAAACTCTTCCTCCTCTTCCCAAGAATCAACCTTAACCAAAACTTA
CATTGATACGCTTTTAAACCTGCCTTGATGACAAAAGAGCAAAGATAACA
GTGATGTTAAAAACTTAATTAAGACGTTAGATAAAAACCACACTGGTTTA
GATAAGGTTAAAGAAAGGATTGTTGAGTATTTAGCAGTACAACTAAGAAC
CCAAAAAAACAAAGGTCCTATTATGTGTTTAGTAGGTCCTCCTGGGGTTG
GTAAATCAAGTCTAGCTAAGTCTATTGCAGAAGCATTAGATAAGAAGTTT
GTCAAGATCTCATTAGGGGGAGTACATGATGAATCGGAAATCAGAGGTCA
CCGTAAAACTTACTTAGGTTCTATGCCAGGAAGGATTTTGAAAGGGATGA
CCCGTGCTAAGGTAATTAATCCCCTCTTTTTACTTGATGAAATTGATAAG
ATGACCTCCTCCAACCAAGGTTATCCTTCAGGTGCTTTACTTGAAGTATT
AGATCCAGAGTTAAATAATAAGTTTAGTGATAACTATGTTGAAGAAGATT
ATGATCTTTCTAAAGTAATGTTTATCGCTACTGCAAACTACATAGAAGAT
ATCCCTGAAGCTTTACTTGATAGGATGGAGATAATTGAACTCACTTCCTA
TACAGAACAAGAGAAGATTGAGATAGCAAAAAACCACTTAATTAAGCGTT
GCCTTGAGGATGCTGATCTTAACAGTGAAGAATTGAAGTTCACTGATGAA
GCAATCAGCTACATCATTAAGTTTTACACAAGAGAAGCGGGGGTTAGACA
ATTAGAACGATTAATCCAACAAGTTGTAAGAAAGTACATAGTAGCAATGC
AAAAAGATGGCATCAAACAAGAAACGATTGATGTAAACGCTGTTAAAAAA
TACCTTAAGAAGGAGATCTTTGATCACACTATGCGTGATGAAGTGTCTCT
ACCTGGAATTGTCAACGGGATGGCATACACCCCAACTGGAGGGGACTTAC
TTCCCATAGAAGTTACCCATGTTGCTGGTAAAGGAGAGTTGATCTTAACT
GGTAATTTAAAGCAAACAATGCGAGAAAGCGCTAATGTTGCTTTAGGCTA
TGTAAAAGCTAATGCAGAGCGTTTTAACATTAATCCTAGTTTGTTTAAAA
AGATTGATATTAACATCCATGTTCCAGGTGGGGGAATTCCTAAGGATGGA
CCTAGTGCTGGTGCTGCTTTGGTAACTGCAATCATCTCATCATTAACTGG
TAAGAAAGTAGATCCTACAGTGGCTATGACAGGAGAGATCACTTTAAGAG
GCAAAGTGTTGGTTATTGGTGGGGTGAAAGAAAAAACTATCTCAGCTTAC
CGCGGTGGGGTTACAACTATCTTTATGCCTGAGAAAAACGAGCGCTATTT
AGATGAAGTACCCAAAGAGATAGTAGATAAACTTAACATTATCTTTGTTA
AGGAATACAGTGATATCTACAACAAGCTTTTCAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy