Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR174 IGR169 IGR170 IGR172 IGR173 IGR171 MG240 rpL21, - MG232 nrdI, - MG230 nfo, - MG235 MG237 nrdF, - MG229 tig, - MG238 nrdE, - MG231 lon, - MG239 MG240 rpL21, - MG232 nrdI, - MG230 nfo, - MG235 MG237 nrdF, - MG229 tig, - MG238 nrdE, - MG231 lon, - MG239 Type: inverted, Name:  - 49 Type: inverted, Name:  - 49 MG240 nfo, - MG235 MG237 nrdF, - MG229 tig, - MG238 nrdE, - MG231 lon, - MG239 rpL27, - MG234 MG236 MG236 ysxB, - MG233 rpL27, - MG234 rpL21, - MG232 nrdI, - MG230 ysxB, - MG233
* Calculated from Protein Sequence

Gene ID: MG236

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Mycoplasma-specific hypothetical protein

Gene Start:
280663

Gene Stop:
281082

Gene Length:
420

Molecular Weight*:
16504

pI*:
8.16

Net Charge*:
2.58

EC:
 

Functional Class:
Unknown; Mycoplasma-specific protein  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single hit in gapped BLAST to Y236_MYCPN: residues 2-140 are 56% similar to this hypothetical protein.

MG236 is orthologously related to MP0507: residues 2-140 of MG236 are 56% similar to residues 19-157 of MP0507, a predicted MG236 homolog from M. pneumoniae. No similarity to C. trachomatis, C. pneumoniae, U. urealyticum or T. pallidum sequences.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 71-95 are similar to block PR00747G, concerned with glycosyl hydrolase
sequences, e.g. D86967.

ProDom Summary:  Protein Domain Search
Residues 1-140 constitute a defined domain of Y236_MYCGE.

Paralogs:  Local Blast Search
No paralogs in M. genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLTSYVKVLEQNNLRLTKPRIALLKCLIEHQDWHNLSQIKTHLDLANQPS
TLASIYNNLRILAKLKLINIFVDPERFETYYCLRHAEHNHIYLFDEVKQQ
FFTLPLTDGQIKTLLETQNHTSKVKLNDFYIVARGEINND

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAACTAGTTATGTGAAGGTATTAGAACAAAACAATCTGCGCTTAAC
AAAACCGCGGATTGCTTTATTAAAGTGTTTAATTGAACACCAAGATTGGC
ATAATCTCTCCCAAATTAAAACCCACCTTGATTTAGCCAATCAACCCTCA
ACACTCGCTTCTATCTACAACAACTTAAGAATCCTAGCTAAACTTAAACT
GATTAACATCTTTGTAGATCCAGAGCGGTTTGAAACTTACTATTGCCTGC
GCCATGCAGAGCATAACCATATCTATCTTTTTGATGAAGTTAAACAGCAG
TTTTTTACCTTACCTTTAACAGATGGCCAAATTAAAACATTGCTTGAAAC
CCAAAACCATACCAGTAAGGTAAAGCTTAATGATTTTTATATTGTTGCTA
GGGGTGAGATAAACAATGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy