Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR167 IGR169 IGR168 IGR170 IGR172 IGR171 IGR166 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 MG237 nrdF, - MG229 tig, - MG238 aroP?, - MG226 nrdE, - MG231 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 MG237 nrdF, - MG229 tig, - MG238 aroP?, - MG226 nrdE, - MG231 Type: direct, Name:  - 42 Type: inverted, Name:  - 56 Type: direct, Name:  - 26 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 MG237 nrdF, - MG229 tig, - MG238 aroP?, - MG226 nrdE, - MG231 rpL27, - MG234 MG236 MG236 ysxB, - MG233 rpL27, - MG234 rpL21, - MG232 ysxB, - MG233
* Calculated from Protein Sequence

Gene ID: MG231

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nrdE  

Definition:
ribonucleoside diphosphate reductase alpha subunit

Gene Start:
276646

Gene Stop:
278808

Gene Length:
2163

Molecular Weight*:
82242

pI*:
7.00

Net Charge*:
0.00

EC:
1.17.4.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
Catalyzes formation of deoxyribonucleosides from ribonucleosides. The enzyme is typically a tetramer of two alpha and two beta chains. For the beta subunit sequence, see MG229. For a graphic view of the apparent inversion of this region compared to the same region in M. pneumoniae, use the Bugspray analysis program (go to our home page, under the side bar Analysis Tools, select Genome Alignments).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ribonucleoside diphosphate reductase alpha sequences, e.g. residues 1-721 are 87% similar to RIR1_MYCPN. Residues 19-721 are 57% similar to RIR1_MYCTU.

MG231 is orthologously related to MP0512: residues 1-721 of MG231 are 87% similar to residues 1-721 of MP0512, a predicted ribonucleoside-diphosphate reductase from M. pneumoniae. MG231 is also similar to predicted ribonucleoside diphosphate reductase alpha subunit sequences from T. pallidum (TP1008), C. pneumoniae (CPn0984) and C. trachomatis (CT827).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0209 is Ehgpc-Yu.
COG name: Ribonucleotide reductase alpha subunit.
Functional Class: F
BeTs to e-g-c-yu


Blocks Summary:  Blocks Search
Residues 159-702 represent seven segments with matches to blocks BL00089B,
C,D,F,H,I, concerned with ribonucleoside diphosphate reductases, e.g.
RIR1_HELPY.

ProDom Summary:  Protein Domain Search
Residues 1-31, 32-118, 119-225, 611-699, 700-721 constitute defined domains of
RIR1_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 96 to 170 (E-value = 1.9e-21) place MG231 in the Ribonuc_red_lgN family which is described as Ribonucleotide reductase, all-alpha domain (PF00317)
Residues 173 to 700 (E-value = 1.1e-159) place MG231 in the Ribonuc_red_lgC family which is described as Ribonucleotide reductase, barrel domain (PF02867)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
409  
481

PDB Hit:
gi|2914234|pdb|4R1R|A Chain A, Ribonucleotide Reductase R1 Protein With Substrate, Gdp And Effector Dttp From Escherichia Coli Ribonucleotide Reductase, Deoxyribonucleotide Synthesis, Radical Chemistry, Allosteric Regulation, Specificity, Complex (Oxidore

Gene Protein Sequence:
MTSKEKIPTFNTEEDVESYISFNAQAKIYDDFAIDLQAVESYIQEHVKPK
TKVFHSTKERLDFLIKNDYYDEKIINMYSFEQFEEITHKAYSYRFRYANF
MGAFKFYNAYALKTFDGKYYLENYEDRVVMNVLMLANGNFNKALKLLKQI
ILNRFQPATPTFLNAGRKKRGEFVSCYLLRIEDNMESIGRAITTTLQLSK
RDGGVALLLSNLREAGAPIKKIENQSSGIIPIMKLLEDSFSYSNQLGQRQ
GAGAVYLHCHHPDVMQFLDTKRENADEKIRIKSLSLGLVIPDITFQLAKN
NEMMALFSPYDIYQEYGKALSDISVTEMYYELLENQRIKKTFISARKFFQ
TIAELHFESGYPYILFDDTVNRRNAHKNRIVMSNLCSEIVQPSLPSEFYS
DLTFKKVGSDISCNLGSLNIARAMESGSELAELIQLAIESLDLVSRISSL
ETAPSIKKGNSENHALGLGAMNLHGFLATNAIYYDSKEAVDFTNIFFYTV
AYHAFSASNKLALELGKFKDFENTKFADGSYFDKYTKVASDFWTCKTEKV
QALFDKYQVKIPTQENWKQLVASIQKDGLANSHLMAIAPTGSISYLSSCT
PSLQPVVSPVEVRKEGKLGRIYVPAYKLDNDNYQYFKDGAYELGFEPIIN
IVAAAQQHVDQAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVRQ
DVLKDSEDHTIKIKDCEVCSI

Gene Nucleotide Sequence:  Sequence Viewer
ATGACATCCAAAGAAAAAATCCCTACTTTTAATACTGAAGAAGATGTTGA
AAGTTACATTTCTTTTAATGCCCAAGCCAAAATCTATGATGATTTTGCAA
TCGATTTACAAGCAGTTGAAAGCTATATTCAAGAGCATGTAAAACCCAAA
ACTAAGGTCTTTCATTCCACCAAAGAACGCCTTGATTTTCTGATTAAGAA
CGATTATTATGATGAGAAGATCATCAACATGTACAGTTTTGAACAGTTTG
AAGAGATCACCCATAAAGCATATTCATACCGCTTTCGTTATGCTAACTTC
ATGGGAGCATTTAAGTTCTATAATGCCTATGCTTTAAAGACATTTGATGG
TAAGTACTACTTGGAAAACTATGAGGATAGGGTGGTGATGAATGTATTGA
TGTTAGCTAATGGTAACTTCAATAAGGCATTAAAACTCTTAAAACAGATT
ATCCTTAACCGTTTTCAACCAGCAACCCCTACCTTTCTTAATGCTGGTAG
AAAGAAACGTGGTGAATTTGTTTCATGTTACCTGTTAAGGATTGAAGATA
ACATGGAATCAATAGGTAGAGCGATAACAACTACACTACAACTATCAAAA
CGTGATGGGGGAGTAGCACTTTTGCTTTCCAACTTACGTGAAGCGGGAGC
GCCCATCAAAAAGATAGAAAACCAATCATCAGGGATTATCCCAATTATGA
AATTGTTAGAGGACTCTTTTTCCTATTCCAACCAACTTGGACAAAGACAA
GGAGCGGGAGCGGTGTATCTCCATTGTCACCATCCTGATGTTATGCAGTT
TTTAGATACTAAAAGGGAAAATGCTGATGAGAAGATCAGAATTAAATCAC
TCTCCTTAGGACTTGTGATTCCAGATATCACCTTCCAATTAGCAAAAAAT
AACGAGATGATGGCACTTTTCAGTCCATATGATATCTATCAGGAGTATGG
TAAGGCTTTATCTGATATCTCAGTAACTGAGATGTATTATGAATTGCTTG
AAAACCAACGCATTAAAAAGACCTTTATTAGTGCTAGAAAGTTCTTTCAA
ACAATTGCTGAACTCCACTTTGAAAGTGGTTATCCCTACATCTTGTTTGA
TGATACAGTTAACAGGAGAAATGCCCACAAAAACAGGATAGTAATGTCTA
ACCTTTGCAGTGAAATTGTCCAACCATCTTTACCTTCTGAATTCTATTCA
GACCTTACTTTTAAAAAGGTAGGTAGTGATATTAGCTGTAACTTGGGGAG
TTTAAATATTGCTAGAGCAATGGAAAGTGGTAGTGAGTTAGCTGAATTGA
TTCAACTAGCAATTGAATCACTGGATTTAGTGTCAAGGATCAGTAGTTTA
GAAACCGCTCCTTCCATTAAAAAAGGTAATTCAGAAAACCATGCGTTGGG
ATTAGGAGCGATGAACTTACATGGATTTTTAGCAACAAATGCTATCTATT
ATGATTCAAAGGAAGCGGTTGATTTTACTAACATCTTTTTTTATACAGTA
GCATACCATGCGTTTAGTGCTTCCAATAAATTAGCATTGGAACTAGGTAA
ATTTAAAGACTTTGAAAATACTAAATTTGCTGATGGTAGTTACTTTGATA
AGTACACTAAGGTAGCTAGTGACTTTTGAACATGTAAAACAGAAAAAGTT
CAAGCCCTTTTTGATAAATACCAAGTAAAAATTCCAACTCAGGAAAATTG
GAAGCAATTGGTAGCAAGTATCCAAAAAGATGGACTTGCAAACTCCCATT
TAATGGCTATTGCCCCAACTGGATCTATCTCATATCTCTCTTCATGTACC
CCTTCACTTCAACCAGTAGTATCTCCTGTTGAAGTGAGAAAAGAAGGGAA
GTTAGGACGGATTTATGTCCCTGCTTATAAGCTTGATAATGATAACTATC
AGTACTTTAAAGATGGTGCTTATGAACTGGGCTTTGAACCTATTATTAAC
ATAGTAGCAGCAGCCCAACAACATGTTGATCAAGCAATCTCTTTAACCTT
GTTTATGACTGATAAAGCTACCACCAGAGATCTCAATAAAGCTTATATTT
ATGCTTTTAAAAAGGGTTGTAGTTCTATCTATTATGTCAGAGTAAGACAA
GATGTTTTAAAAGATAGTGAAGATCACACTATTAAAATCAAGGATTGTGA
GGTTTGTTCTATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy