Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR167 IGR169 IGR168 IGR170 IGR165 IGR171 IGR166 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 nrdF, - MG229 aroP?, - MG226 MG225 nrdE, - MG231 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 nrdF, - MG229 aroP?, - MG226 MG225 nrdE, - MG231 Type: direct, Name:  - 42 Type: inverted, Name:  - 56 Type: direct, Name:  - 26 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 nrdF, - MG229 aroP?, - MG226 MG225 nrdE, - MG231 rpL27, - MG234 ysxB, - MG233 rpL27, - MG234 rpL21, - MG232 ysxB, - MG233
* Calculated from Protein Sequence

Gene ID: MG229

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nrdF  

Definition:
ribonucleoside diphosphate reductase beta subunit

Gene Start:
275140

Gene Stop:
276159

Gene Length:
1020

Molecular Weight*:
39138

pI*:
6.02

Net Charge*:
-3.63

EC:
1.17.4.1  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
Catalyzes formation of deoxyribonucleosides from ribonucleosides. The enzyme is typically a tetramer of two alpha and two beta chains. For the alpha subunit sequence, see MG231.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to beta subunit sequences, e.g. residues 3-340 are 89% similar to the reductase beta subunit of M. pneumoniae (AE000050).

MG229 is orthologously related to MP0514: residues 3-340 of MG229 are 89% similar to residues 2-339 of MP0514, a predicted ribonucleotide reductase 2 from M. pneumoniae. MG229 is also similar to predicted ribonucleoside diphosphate reductase beta subunits from T.pallidum (TP0053), C.trachomatis (CT828) and C. pneumoniae (CPn0985).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0208 is Ehgpc-Yu.
COG name: Ribonucleotide reductase beta subunit.
Functional Class: F
BeTs to e-g-c--u.


Blocks Summary:  Blocks Search
Residues 34-315 encompass eight segments with matches to blocks BL00368A-D,
concerned with ribonucleoside diphosphate reductase sequences, e.g. RIR2_MYCGE.

ProDom Summary:  Protein Domain Search
Residues 1-44, 45-135, 136-232, 233-340 constitute defined domains of RIR2_MYCGE.

Paralogs:  Local Blast Search
No paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 24 to 302 (E-value = 7.5e-40) place MG229 in the Ribonuc_red_sm family which is described as Ribonucleotide reductase, small chain (PF00268)

PDB Hit:
gi|1942079|pdb|1XIK|A Chain A, ribonucleoside-diphosphate reductase 1 beta chain oxidoreductase, DNA replication, iron Mol_id: 1; Molecule: protein R2 of ribonucleotide rReductase; Chain: A, B; Fragment: beta chain; Synonym: Rnr R2; Ec: 1.17.4.1.

Gene Protein Sequence:
MAANNKKYFLESFSPLGYVKNNFQGNLRSVNWNLVDDEKDLEVWNRIVQN
FWLPEKIPVSNDIPSWKKLSKDWQDLITKTFTGLTLLDTIQATIGDICQI
DHALTDHEQVIYANFAFMVGVHARSYGTIFSTLCTSEQINAAHEWVVNTE
SLQKRAKALIPYYTGNDPLKSKVAAALMPGFLLYGGFYLPFYLSSRKQLP
NTSDIIRLILRDKVIHNYYSGYKYQRKLEKLPLAKQKEMKAFVFELMYRL
IELEKDYLKELYEGFGIVDDAIKFSVYNAGKFLQNLGYDSPFTAAETRIK
PEIFAQLSARADENHDFFSGNGSSYVMGVSEETNDDDWNF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCTAACAATAAAAAGTACTTTTTAGAATCATTTTCCCCACTTGG
GTATGTAAAGAATAATTTTCAGGGCAACTTACGTTCTGTAAACTGGAATT
TGGTTGATGATGAGAAGGATTTGGAAGTGTGAAACAGGATTGTTCAGAAC
TTTTGGTTACCTGAAAAGATCCCTGTATCCAATGACATCCCCTCATGAAA
GAAACTCTCAAAGGATTGACAGGATCTGATCACTAAGACCTTTACTGGTT
TAACACTACTTGATACTATCCAAGCTACCATTGGTGACATCTGTCAAATT
GATCATGCTCTAACTGATCATGAGCAGGTTATTTATGCAAACTTTGCTTT
TATGGTAGGGGTACATGCCCGTTCCTATGGAACGATCTTCTCAACTTTAT
GTACATCAGAACAGATTAACGCTGCTCATGAGTGGGTTGTAAACACTGAA
AGTCTCCAGAAAAGAGCAAAGGCATTAATCCCTTACTATACGGGCAATGA
CCCGTTAAAATCAAAGGTAGCAGCAGCTTTAATGCCTGGGTTTTTACTGT
ATGGTGGGTTTTATTTGCCTTTTTACTTGTCATCAAGAAAACAACTACCA
AATACATCTGATATTATCCGCTTAATCCTTCGTGATAAAGTGATCCATAA
CTATTACAGTGGTTATAAATACCAACGTAAACTAGAAAAACTCCCTTTAG
CAAAACAAAAGGAGATGAAAGCATTTGTTTTTGAACTAATGTATCGGTTA
ATTGAACTTGAAAAGGACTATTTAAAAGAGCTTTATGAAGGGTTTGGAAT
TGTTGATGATGCCATTAAGTTCAGTGTTTACAATGCTGGTAAGTTTTTAC
AGAACTTAGGTTATGACTCCCCGTTTACTGCAGCAGAAACCAGGATTAAA
CCAGAGATTTTTGCCCAACTATCAGCACGTGCTGATGAAAACCATGACTT
TTTCTCAGGAAACGGTTCGTCGTATGTGATGGGAGTTAGTGAAGAGACAA
ATGATGATGATTGGAACTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy