Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR167 IGR169 IGR168 IGR170 IGR164 IGR165 IGR171 IGR166 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 nrdF, - MG229 ftsZ, - MG224 aroP?, - MG226 MG225 nrdE, - MG231 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nfo, - MG235 nrdF, - MG229 ftsZ, - MG224 aroP?, - MG226 MG225 nrdE, - MG231 Type: direct, Name:  - 42 Type: inverted, Name:  - 56 Type: direct, Name:  - 26 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nrdF, - MG229 ftsZ, - MG224 aroP?, - MG226 MG225 nrdE, - MG231 rpL27, - MG234 nfo, - MG235 ysxB, - MG233 rpL21, - MG232 rpL27, - MG234 ysxB, - MG233
* Calculated from Protein Sequence

Gene ID: MG228

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dhfR  dyr  

Definition:
dihydrofolate reductase

Gene Start:
274652

Gene Stop:
275131

Gene Length:
480

Molecular Weight*:
18950

pI*:
9.74

Net Charge*:
5.14

EC:
1.5.1.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Folate  
Central intermediary metabolism; one carbon metabolism  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis
Metabolism of Cofactors, Vitamins, and Other Substances; One carbon pool by folate

Secondary Evidence:
Rood JI, Laird AJ, Williams JW. 1980. Cloning of the Escherichia coli K-12 dihydrofolate reductase gene following mu-mediated transposition. Gene 8(3):255-65. Medline: 6444603.

Comment:
Enzymatic reaction:
5,6,7,8-Tetrahydrofolate + NADP(+) = 7,8-Dihydrofolate + NADPH.

Essential step for de novo glycine and purine synthesis, DNA precursor synthesis, and for the conversion of dUMP to dTMP.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to dihydrofolate reductase sequences, e.g. residues 1-157 are 48% similar to DYR_MYCPN. Residues 2-137 are 37% similar to the protein from S. pneumoniae (Z74777).

MG228 is orthologously related to MP0515: residues 1-157 of MG228 are 52% similar to residues 1-157 of MP0515, a predicted dihydrofolate reductase from M. pneumoniae. MG228 is also similar to predicted dihyrofolate reductases from U. urealyticum (UU114), M. pneumoniae (MP0536), C. trachomatis (CT612), and C. pneumoniae (CPn0759).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0262 is EhgP--y-.
COG name: Dihydrofolate reductase.
Functional Class: H
BeTs to -hg---y-


Blocks Summary:  Blocks Search
Residues 5-35, 4-34, 40-51, 52-64, 98-107 are matched to blocks BL00075A-D,
concerned with dihydrofolate reductase sequences, e.g. DYRA_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 1-158, 38-107, 112-132 constitute defined domains of DYR_MYCGE
or Y213_MYCPN.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 159 (E-value = 6.5e-20) place MG228 in the DiHfolate_red family which is described as Dihydrofolate reductase (PF00186)

PDB Hit:
gi|1311152|pdb|1DIU| Dihydrofolate Reductase (E.C.1.5.1.3) Complex With Brodimoprim-4,6-Dicarboxylate InhibitorENZYME COMPLEX Mol_id: 1; Molecule: Dihydrofolate Reductase; Chain: Null; Ec: 1.5.1.3; Heterogen: Brodimoprim-4,6-Dicarboxylate

Gene Protein Sequence:
MLIAIWAMTQEGLIGNNNTLPWMIKQELAHFKKTTLFQALLMGRKTYESL
PKVFEKRTIFLLSKDQNYRFEEKGSEVKVINDFWPLIKSYQANKEKDLFI
CGGKSVYEQTINECDQLIVSIIKKKYKGDQFLKVDLSKFVLNEVVEFEEF
NVNYYRKKQQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAATTGCTATCTGAGCGATGACACAAGAAGGACTAATAGGTAATAA
CAACACTTTACCTTGGATGATTAAACAAGAGCTAGCTCACTTTAAAAAAA
CTACGTTATTTCAAGCTTTGTTAATGGGGAGAAAAACTTACGAATCACTC
CCCAAGGTATTTGAAAAAAGAACAATATTTCTCCTTTCAAAAGATCAAAA
CTACCGTTTTGAAGAAAAGGGAAGTGAAGTGAAAGTTATTAATGATTTTT
GACCACTAATTAAAAGTTACCAAGCAAATAAAGAAAAGGATTTGTTTATT
TGTGGTGGAAAAAGTGTGTATGAACAGACCATTAATGAATGTGATCAGTT
AATTGTTTCAATCATTAAAAAGAAGTATAAGGGTGATCAGTTTTTGAAGG
TTGATCTCAGTAAATTTGTACTTAATGAAGTTGTAGAGTTTGAGGAATTT
AATGTTAATTATTATAGAAAGAAACAACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy