Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR167 IGR163 IGR169 IGR168 IGR170 IGR164 IGR165 IGR171 IGR166 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nrdF, - MG229 ftsZ, - MG224 MG223 aroP?, - MG226 MG225 nrdE, - MG231 rpL21, - MG232 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nrdF, - MG229 ftsZ, - MG224 MG223 aroP?, - MG226 MG225 nrdE, - MG231 Type: direct, Name:  - 42 Type: inverted, Name:  - 56 Type: direct, Name:  - 26 nrdI, - MG230 dhfR,dyr, - MG228 thyA, - MG227 nrdF, - MG229 MG223 aroP?, - MG226 MG225 nrdE, - MG231 ysxB, - MG233 rpL21, - MG232 ftsZ, - MG224 ysxB, - MG233
* Calculated from Protein Sequence

Gene ID: MG227

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thyA  

Definition:
thymidylate synthase

Gene Start:
273789

Gene Stop:
274649

Gene Length:
861

Molecular Weight*:
33456

pI*:
8.93

Net Charge*:
3.64

EC:
2.1.1.45  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; 2'-Deoxyribonucleotide metabolism  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis
Metabolism of Cofactors, Vitamins, and Other Substances; One carbon pool by folate
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
This enzyme is typically responsible for supplying dTMP de novo.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to thymidylate synthase sequences, e.g. residues 1-287 are 74% similar to TYSY_MYCPN. Residues 4-287 are 52% similar to TYSY_STAAU.

MG227 is orthologously related to MP0516: residues 1-287 of MG227 are 74% similar to residues 42-328 of MP0516, a predicted thymidylate synthase from M. pneumoniae. No significant similarities observed to C. trachomatis, C. pneumoniae, U. urealyticum or T. pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0207 is ehgp-my-.
COG name: Thymidylate synthase.
Functional Class: F
BeTs to e-g--my-.


Blocks Summary:  Blocks Search
Residues 3-31, 42-65, 117-130, 130-174, 181-229, 262-287 are matched to
blocks BL00091A-F, concerned with thymidylate synthase sequences, e.g.
TYSA_BACAM, TYSY_STAAU, TYSY_LACCA.

ProDom Summary:  Protein Domain Search
Residues 20-265 constitute a defined domain of TYSY_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 287 (E-value = 2.6e-154) place MG227 in the Thymidylat_synt family which is described as Thymidylate synthase (PF00303)

PDB Hit:
gi|231091|pdb|4TMS| Thymidylate Synthase (E.C.2.1.1.45)

Gene Protein Sequence:
MKQYLDLASYVLANGKKRKNRTDTDTLSVFGYQMKFDLTNSFPLLTTKKV
NWKAIVHELLWFIKGDTNIKYLVDNGVNIWNEWPYENFKKSPSFQNETLQ
EFILKVKTDNEFAKQFADLGPVYGKQWRNFNGVDQLKKVIQEIKENPNSR
RLIVSSWNPSELEKMALAPCHSLFQFYVEEDKLSLQLYQRSGDIFLGVPF
NIASYALLVYLVAHETKLKPGYFIHTLGDAHIYENHIEQIKLQLTRTTLD
PPQVVLKSDKSIFAYSFDDIELVGYNYHPFIYGRVAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAGTATTTAGATTTAGCTAGTTATGTTTTAGCAAATGGTAAAAA
AAGAAAAAACCGTACAGATACAGATACTTTAAGTGTCTTTGGTTACCAGA
TGAAATTTGACCTTACTAATAGTTTTCCTTTATTGACAACTAAAAAGGTT
AATTGGAAGGCAATTGTCCATGAATTGTTGTGATTTATTAAGGGTGATAC
CAACATTAAGTACTTAGTTGATAATGGGGTGAACATCTGAAATGAATGAC
CATATGAAAACTTTAAAAAATCACCAAGTTTTCAAAACGAAACACTCCAA
GAATTTATCTTAAAGGTTAAAACTGATAATGAGTTTGCTAAACAATTTGC
TGATTTGGGTCCTGTTTATGGCAAGCAATGACGTAATTTTAATGGTGTTG
ATCAACTCAAAAAAGTCATCCAAGAGATTAAAGAAAATCCCAACTCAAGA
AGGCTAATTGTCTCAAGCTGAAACCCTAGTGAATTGGAAAAAATGGCATT
GGCTCCTTGTCATTCACTCTTTCAGTTCTATGTTGAAGAAGATAAACTAA
GCTTACAGCTTTACCAGCGCAGCGGTGATATCTTTCTTGGTGTCCCATTT
AACATTGCATCTTACGCCTTACTTGTGTATTTAGTTGCTCATGAAACTAA
GTTAAAACCTGGTTATTTTATCCATACACTAGGAGATGCACATATCTATG
AAAACCACATTGAACAAATTAAATTACAACTAACAAGAACAACCCTAGAC
CCCCCTCAAGTGGTTTTGAAAAGTGATAAATCAATCTTTGCTTATAGTTT
TGATGATATTGAGTTAGTTGGTTATAATTACCATCCATTTATCTATGGGA
GGGTTGCAGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy