Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR152 IGR156 IGR155 IGR151 lsp, - MG210 rluD, - MG209 MG211.1 MG207 MG211 MG210.1 pfk, - MG215 uvrC, - MG206 MG213 pyk, - MG216 lsp, - MG210 rluD, - MG209 MG211.1 MG207 MG211 MG210.1 pfk, - MG215 uvrC, - MG206 MG213 pyk, - MG216 lsp, - MG210 rluD, - MG209 MG208 MG208 MG207 MG211 MG210.1 pfk, - MG215 uvrC, - MG206 MG213 pyk, - MG216 MG214 plsC, - MG212 MG214 plsC, - MG212 MG211.1
* Calculated from Protein Sequence

Gene ID: MG211

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Mycoplasma-specific hypothetical protein

Gene Start:
250997

Gene Stop:
251437

Gene Length:
441

Molecular Weight*:
17454

pI*:
4.75

Net Charge*:
-8.31

EC:
 

Functional Class:
Unknown; Mycoplasma-specific protein  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-147 are 56% similar to Y211_MYCPN, a hypothetical.
No other significant hits were seen in gapped BLAST.

MG211 is orthologously related to MP0539: residues 1-147 of MG211 are 64% similar to residues1-149 of MP0539, a predicted MG211 homolog from M. pneumoniae. No significant similary to U. urealyticum, C. trachomatis, C. pneumoniae or T. pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-147 contitute a defined domain in Y211_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
35  
132

PDB Hit:


Gene Protein Sequence:
MDNKNPQKLITSELLANHRFNFAKDDKGGYDANEVDAFLDQLTKTLIHYE
EMKNNEQELKNAYDKLFSDRDQILSRCAKLEADLNTFYENGYANKVLINR
VQELEDKLEKLPDRYTEKLERIEKLLKKVIKHWTDGEDISNFEDEFF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAATAAAAACCCCCAGAAACTTATTACTAGTGAATTGTTGGCAAA
CCACCGCTTTAATTTTGCTAAAGATGATAAAGGTGGGTATGATGCTAATG
AAGTTGATGCATTCTTAGATCAACTAACCAAGACTTTAATCCACTATGAG
GAGATGAAAAACAACGAACAAGAATTGAAAAATGCTTATGACAAGTTGTT
TTCAGATCGTGATCAGATTTTAAGTCGTTGTGCTAAATTAGAAGCTGATT
TAAACACCTTTTATGAAAATGGTTATGCAAACAAGGTGTTAATTAACCGG
GTTCAGGAGTTGGAGGATAAACTTGAAAAACTACCTGATCGTTACACTGA
AAAACTAGAAAGGATTGAAAAACTGTTAAAAAAGGTCATTAAACACTGAA
CTGATGGGGAGGACATTAGTAACTTTGAAGATGAGTTTTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy