Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR152 IGR155 IGR151 IGR150 lsp, - MG210 rluD, - MG209 hrcA, - MG205 MG211.1 MG207 MG211 MG210.1 pfk, - MG215 uvrC, - MG206 MG213 lsp, - MG210 rluD, - MG209 hrcA, - MG205 MG211.1 MG207 MG211 MG210.1 pfk, - MG215 uvrC, - MG206 MG213 lsp, - MG210 rluD, - MG209 hrcA, - MG205 MG208 MG208 MG207 MG211 MG210.1 pfk, - MG215 uvrC, - MG206 MG213 MG214 plsC, - MG212 MG214 plsC, - MG212 MG211.1
* Calculated from Protein Sequence

Gene ID: MG210.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Mycoplasma-specific hypothetical protein

Gene Start:
250148

Gene Stop:
250804

Gene Length:
657

Molecular Weight*:
25937

pI*:
0.00

Net Charge*:
0.00

EC:
 

Functional Class:
Unknown; Mycoplasma-specific protein  

Pathway: pathway table

Comment:
This protein is not in the original genbank record.

Blast Summary:  PSI-Blast Search
Gapped BLAST reveals two significant hits, both to conserved hypothetical proteins in Mycoplasma: residues 1-219 are 93% similar to (U39700) conserved hypothetical protein of Mycoplasma genitalium; and residues 1-214 are 68% similar to hypothetical protein H10_orf220L of Mycoplasma pneumoniae (SGC3).

MG210.1 is orthologously related to MP0540: residues 1-214 of MG210.1 are 69% similar to residues 1-216 of MP0540, a predicted
Mycoplasma-specific hypothetical protein from M. pneumoniae. No significant similarity to C. trachomatis, C. pneumoniae, T. pallidum, or U. urealyticum sequences.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-218 are 69% similar to a defined domain of P75482_MYCPN defined as: H10_ORF220L PROTEIN.

Paralogs:  Local Blast Search
No paralogs in M. genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LGKTKNKSDWQIFLEDYRFYFETDFDWVTYLNNCLNSYPDFDIIKFIKKY
GPECEKSFLSWQSKAKSDVYSELTNKIKKQQFSEQLIYQLVQLDALRTNY
LIGSLFSDNKTQRKLLKRSWKNAKKEGYTKQEWLMILVGLPFEKGAYHKQ
LYDHSRQEILDLTEVIKKLYLKTETNNDKLEFAATTSKTTAQLTKTMPLN
SSDLDKDLMEFSGEKWGDN

Gene Nucleotide Sequence:  Sequence Viewer
TTGGGGAAAACAAAAAACAAATCAGACTGACAGATCTTTCTAGAAGATTA
CCGTTTTTATTTTGAAACAGATTTTGATTGGGTTACATACCTGAACAACT
GTTTAAACAGCTATCCTGATTTTGACATCATCAAGTTCATTAAGAAGTAT
GGCCCTGAGTGTGAAAAGAGCTTTCTAAGCTGACAGAGCAAAGCTAAGAG
TGATGTTTACAGTGAACTGACTAACAAGATTAAAAAACAACAGTTCTCAG
AACAGTTAATTTACCAGCTAGTCCAACTTGATGCTTTACGAACTAACTAT
TTAATTGGTTCGTTGTTTTCAGATAACAAAACCCAGCGCAAACTCCTGAA
GCGTTCTTGAAAAAATGCTAAGAAAGAAGGTTATACAAAACAAGAATGGT
TGATGATCTTAGTTGGTTTACCCTTTGAAAAAGGTGCTTATCATAAGCAG
TTATATGACCATTCACGTCAGGAGATCTTAGATCTTACTGAAGTTATTAA
AAAGCTTTATCTAAAAACAGAGACCAACAACGATAAGCTTGAGTTTGCTG
CAACTACTAGTAAAACAACAGCGCAGCTAACTAAAACTATGCCCTTAAAC
AGTAGTGATCTTGATAAGGATCTAATGGAGTTTAGTGGTGAGAAGTGAGG
TGATAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy