Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR152 IGR149 IGR151 IGR150 lsp, - MG210 rluD, - MG209 hrcA, - MG205 MG211.1 MG207 MG211 MG210.1 uvrC, - MG206 MG213 parC, - MG204 lsp, - MG210 rluD, - MG209 hrcA, - MG205 MG211.1 MG207 MG211 MG210.1 uvrC, - MG206 MG213 parC, - MG204 lsp, - MG210 rluD, - MG209 hrcA, - MG205 MG208 MG208 MG207 MG211 MG210.1 uvrC, - MG206 MG213 parC, - MG204 plsC, - MG212 plsC, - MG212 MG211.1
* Calculated from Protein Sequence

Gene ID: MG209

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rluD  

Definition:
pseudouridine synthase (uracil hydrolase)

Gene Start:
249402

Gene Stop:
248479

Gene Length:
924

Molecular Weight*:
34982

pI*:
10.51

Net Charge*:
20.69

EC:
4.2.1.70  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:
In E.coli, this protein is thought to belong to the YabO/YceC/SfhB family and play a role as a suppressor of the temperature-sensitivity of the FtsH1(ts) mutation. RLUA_ECOLI is responsible for the synthesis of pseudouridine from uracil-746 in 23S rRNA and position 32 in the anticodon stem of tRNAs, and RsuA (RSUA_ECOLI) is responsible for the synthesis of pseudouridine from uracil-516 in 16S rRNA.

See Koonin, EV. 1996. Pseudouridine synthases: four families of enzymes containing a putative uridine-binding motif also conserved in dUTPases and dCTP deaminases. Nucleic Acids Res 24(12):2411-5. Medline: 8710514.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to conserved hypothetical proteins in bacteria, some of the SFHB family, e.g. residues 36-283 are 34% similar to YHCT_BACSU. Residues 12-249 are 30% similar to an uncharacterized protein from B. burgdorferi (AE001116).

MG209 is orthologously related to MP0543: residues 1-308 of MG209 are 59% similar to residues 1-309 of MP0543, a predicted hypothetical protein from M. pneumoniae. MG209 is also similar to UU313, a hypothetical protein from U. urealyticum. MG209 is also similar to predicted members of the pseudouridine synthase family from C. pneumoniae (CPn0719 and CPn0403) and C. trachomatis (CT658 and CT106). MG209 is similar to TP0339 from T. pallidum, a possible ftsH suppressor protein. MG209 is similar to a predicted pseudouridine synthase from U. urealyticum (UU313). MG209 is also similar to hypothetical proteins from M. pneumoniae (MP0294) and T. pallidum (TP0231 and TP0154).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0564 is EHGPC-YU.
COG name: Predicted pseudouridylate synthases.
Functional Class: J
BeTs to -hg-c-yu.


Blocks Summary:  Blocks Search
Residues 10-52, 82-102, 127-169, 200-208, 225-249, 259-264
are members of blocks BL01129A-E (uncharcterized proteins).

ProDom Summary:  Protein Domain Search
Residues 1-70, 82-169, 175-260 constitute defined domains of Y209_MYCGE.

Paralogs:  Local Blast Search
MG209 is weakly paralogous to MG370, also a hypothetical protein: residues 11-269 are 28% similar to this protein.

Pfam Summary:  Pfam Search
Residues 11 to 57 (E-value = 1.9e-08) place MG209 in the S4 family which is described as S4 domain (PF01479)
Residues 88 to 237 (E-value = 3.6e-65) place MG209 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

PDB Hit:


Gene Protein Sequence:
MKQCFVVTTTKRLDSLLASLLNLSRVKVVKLIMNGQIKVNEKLTFKNSLI
VAKDDVIKVEIHDETTSDFITSVEPYNLKLEVLFEDKDLMVINKPSGLLT
HPTTFNEKASLLAACIFHNNKNPVYLVHRLDRDTSGAIVVCKNQASLLNL
QNQLQNRTLKRYYVALVHFPFNALTGSINAPLARVNNNKVMFKIAQTAKA
KQAITKFKVINQNEKAALISLELLTGRTHQIRVHLKFIQHPVYNDPLYGI
KSEKKDSYGQFLHANRICFIHPTLNKPMDFHAPLEPKFSTKLKSLNLSLT
DPLHVLFK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAGTGTTTTGTTGTTACAACTACCAAACGCTTAGATAGTCTTTT
AGCTAGCTTACTGAACCTTTCAAGAGTAAAGGTAGTGAAGCTGATCATGA
ATGGACAGATTAAAGTTAATGAAAAACTAACTTTTAAAAACAGTTTAATA
GTTGCAAAAGATGATGTAATTAAAGTTGAGATTCATGATGAGACAACTAG
TGATTTCATTACTAGTGTTGAACCTTATAACTTAAAGCTTGAGGTTCTTT
TTGAAGACAAGGATTTGATGGTTATTAACAAACCATCAGGTTTGTTAACC
CATCCCACCACTTTCAATGAAAAAGCCAGCTTGTTAGCTGCTTGTATCTT
TCACAACAACAAAAACCCTGTTTACTTAGTGCACAGATTGGACCGTGATA
CTAGTGGGGCAATTGTTGTCTGTAAAAACCAAGCAAGCTTATTAAATTTG
CAAAATCAACTGCAAAATCGCACCTTAAAACGTTATTATGTAGCACTAGT
CCACTTCCCTTTTAATGCCTTAACTGGTTCAATTAATGCACCTTTAGCAA
GGGTTAATAACAACAAGGTAATGTTTAAAATAGCCCAAACTGCTAAAGCA
AAGCAAGCAATAACTAAGTTTAAAGTGATTAATCAGAATGAAAAAGCAGC
ACTAATTAGCTTGGAATTGTTAACAGGTAGAACCCACCAAATTAGAGTGC
ATCTGAAATTTATCCAACATCCAGTTTATAATGATCCACTGTATGGAATT
AAAAGTGAAAAGAAAGATAGCTATGGTCAGTTTCTCCATGCAAACAGGAT
CTGTTTTATCCATCCCACTTTAAACAAACCTATGGACTTTCACGCCCCAC
TTGAACCTAAGTTTTCAACGAAACTTAAGAGTTTAAACTTATCTTTAACC
GATCCACTCCATGTTCTTTTTAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy