Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-1 IGR149 IGR148 IGR146 IGR145 IGR151 IGR147 IGR150 MG208 hrcA, - MG205 MG202 MG207 grpE, - MG201 uvrC, - MG206 dnaJ_3, - MG200 parE, - MG203 parC, - MG204 MG208 hrcA, - MG205 MG202 MG207 grpE, - MG201 uvrC, - MG206 dnaJ_3, - MG200 parE, - MG203 parC, - MG204 MG208 hrcA, - MG205 MG202 MG207 grpE, - MG201 uvrC, - MG206 dnaJ_3, - MG200 parE, - MG203 parC, - MG204
* Calculated from Protein Sequence

Gene ID: MG204

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
parC  

Definition:
DNA topoisomerase IV subunit A

Gene Start:
242223

Gene Stop:
244565

Gene Length:
2343

Molecular Weight*:
88506

pI*:
9.91

Net Charge*:
22.81

EC:
5.99.1.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous enzymes

Comment:
Required for cell septation and decatenation of completed chromosomes into progeny.
(See Bailey, et al 1996 GENE 168:77-80)

See UU203, a predicted parE sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA gyrase A sequences, e.g. residues 1-779 are
62% similar to PARC_MYCPN.
MG204 is similar to T.pallidum TP0005, a predicted DNA gyrase A
sequence.It is also similar to the C.trachomatis gyrase A
sequences CT189 and CT660.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0188 is ehgpc-y .
COG name: DNA gyrase (topoisomerase II) A subunit.
Functional Class: L
BeTs to e,g,c,y


Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 31-208, 209-374, 395-423, 399-423, 424-488, 527-549,
550-601, 617-647, 715-781 constitute defined domains of PARC_MYCGE.
In addition to hits to M.genitalium, there are similarities
to GYRA_BACSU.

Paralogs:  Local Blast Search
MG204 is paralogously related to MG004, also thought to be a
topoisomerase IV subunit A sequence: residues 20-682 are
33% similar to residues 32-702 of MG004.

Pfam Summary:  Pfam Search
Residues 32 to 476 (E-value = 9e-250) place MG204 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)
Residues 647 to 696 (E-value = 1.1e-06) place MG204 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
333  
425
coil-coil  
426  
474

PDB Hit:
gi|1633273|pdb|1BGW| Topoisomerase Residues 410 - 1202, Isomerase, Topoisomerase, Dna-Binding, Phosphorylated Nuclear Protein Mol_id: 1; Molecule: Topoisomerase; Chain: Null; Fragment: Residues 410 - 1202; Engineered: Yes

Gene Protein Sequence:
MDQKNNNLFQKAIEEVFAVSFSKYAKYIIQDRALPDLRDGLKPVQRRILY
GMFQMGLKPTTPYKKSARAVGEIMGKYHPHGDSSIYDAIIRMSQSWKNNW
TTVSIHGNNGSVDGDNAAAMRYTETRLSLYGFELLKDIDKKLVSFINNFD
DSEKEPTVLPTLLPNLFINGASGIAAGYATNIAPHNTNELLDSLCLRIDQ
PNCELKQILKIVKGPDFPTGGNVYFEKSLSDIYQAGKGKFIIQAKYEVNK
NLNQIEITQIPYETLKANIVKQIEEIIFDNKLSAIESVIDSSDRNGIRII
IKHKDFLPAEKIMAFLFKHTQLQVNFNLNNTVIANRFPIQIGLLSYLDHF
LKFCHELIINKAKYELELASKRLEIILGLIKAISIIDKIIKLIRSAVDKS
DAREKLIDNFKFTFNQAEAIVSLRLYQLTNTDIFELNQEQNELEKTVISS
EQLIASEKARNKLLKKQFEGYKKQFHQQRRSQICGFINQKKVEESELIEN
KTYGVLITKAGNYHKFESNQLLKSTTDFKSESDTIIFAQTIANTDQIFIV
TSLGNIINIPVYKLAFNSKNKLASLVSKKPILLEYETIVFVGTMNSVNQP
ILVLTSKLGMVKRIDLTKLNIKPLKATLCISLRDKDHLVSAFLQQDDKLI
CLVSDHNYYTVFHTNEIPLISSKGMGVKGMKLKLEDQIKFVVAFEANEPL
VMICSDGSVINLKQTELVVVSRMATAKKLPVKKAINYCFSDATNTQLINF
QGKNGSKLITTSELNQMSKTAISQTRFNKLN

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCAAAAAAACAACAACCTCTTTCAAAAGGCAATTGAAGAAGTCTT
TGCAGTTAGCTTTAGTAAGTATGCTAAATACATCATCCAAGATAGAGCTT
TACCTGATCTAAGAGATGGGTTAAAACCAGTACAAAGACGGATCTTATAT
GGGATGTTTCAAATGGGCTTAAAACCCACCACTCCCTATAAAAAATCAGC
CCGTGCTGTTGGGGAGATCATGGGGAAATACCACCCCCATGGTGATAGTT
CCATTTATGATGCAATTATCAGAATGTCCCAAAGCTGAAAGAACAACTGA
ACAACTGTTTCTATCCATGGTAACAATGGTTCAGTGGATGGGGATAATGC
TGCAGCAATGCGTTACACAGAAACCCGCTTAAGCTTGTATGGATTTGAAC
TATTAAAAGACATTGATAAAAAGTTAGTTAGTTTTATCAATAACTTTGAT
GATAGTGAAAAAGAACCAACGGTTTTACCAACCTTACTGCCTAACCTCTT
TATCAATGGTGCGAGTGGGATAGCTGCTGGATATGCAACTAATATTGCTC
CCCATAACACTAATGAACTATTAGATAGTCTTTGCTTGCGAATAGACCAA
CCTAATTGTGAACTTAAACAAATTTTAAAAATTGTTAAAGGTCCTGATTT
TCCAACAGGGGGTAATGTTTATTTTGAAAAGAGTTTAAGTGATATTTATC
AAGCAGGCAAAGGTAAATTTATTATCCAAGCTAAGTATGAAGTTAACAAG
AACTTAAACCAGATTGAAATTACCCAAATCCCTTATGAAACACTGAAAGC
TAACATTGTCAAACAAATTGAAGAGATTATCTTTGACAATAAACTATCTG
CTATTGAAAGTGTCATTGATAGTTCAGATCGCAACGGCATTAGGATCATT
ATTAAACACAAGGACTTTTTGCCTGCTGAGAAGATCATGGCCTTTTTGTT
TAAACACACCCAACTCCAAGTGAACTTTAACCTTAATAACACCGTGATTG
CTAACCGCTTTCCCATCCAAATTGGTTTACTAAGTTACCTCGATCATTTT
TTAAAGTTTTGTCATGAACTAATTATTAATAAAGCTAAGTATGAACTTGA
GCTTGCAAGCAAGCGCTTGGAAATTATTTTAGGACTAATTAAAGCGATTA
GTATCATTGATAAAATCATCAAATTAATTAGATCAGCAGTTGACAAAAGT
GATGCAAGAGAAAAGTTAATTGATAACTTTAAATTTACTTTTAACCAAGC
AGAGGCAATTGTTAGTTTGCGACTTTACCAACTAACTAACACTGATATTT
TTGAACTTAACCAAGAACAAAATGAACTTGAAAAAACTGTGATTAGTTCA
GAGCAACTAATTGCTAGTGAAAAAGCAAGAAACAAACTCCTAAAAAAACA
GTTTGAAGGTTATAAAAAGCAGTTTCACCAGCAACGAAGGTCACAAATAT
GTGGCTTTATTAACCAAAAAAAGGTGGAGGAAAGTGAGCTAATTGAAAAC
AAAACTTATGGGGTTTTAATCACTAAAGCTGGTAACTACCATAAGTTTGA
ATCTAACCAACTATTAAAAAGCACCACTGATTTTAAAAGTGAGAGTGACA
CAATTATCTTTGCACAAACTATTGCTAATACCGACCAAATTTTTATTGTC
ACTTCACTAGGTAACATTATTAATATCCCTGTTTATAAATTAGCTTTCAA
TTCCAAAAATAAACTAGCAAGTTTAGTTAGTAAAAAACCAATCCTTTTGG
AGTATGAAACGATTGTTTTTGTTGGAACAATGAACAGTGTAAACCAACCA
ATCCTTGTTTTAACTTCCAAACTAGGAATGGTTAAACGGATTGATTTAAC
CAAACTTAACATTAAGCCACTTAAAGCTACTTTGTGTATCTCACTCCGTG
ATAAAGACCATTTAGTAAGTGCATTTTTACAACAAGATGATAAACTGATC
TGTTTAGTGTCTGATCACAACTATTACACTGTTTTTCACACCAATGAGAT
CCCATTAATTAGTAGTAAGGGGATGGGAGTGAAGGGGATGAAGTTAAAAC
TAGAGGATCAAATTAAGTTTGTTGTTGCTTTTGAAGCTAATGAACCGTTA
GTGATGATATGTAGTGATGGTAGTGTCATTAACTTAAAACAAACTGAACT
AGTTGTAGTTAGCAGGATGGCAACTGCAAAAAAACTGCCTGTTAAGAAAG
CAATTAACTATTGTTTTAGTGATGCAACTAACACCCAGTTAATTAATTTT
CAGGGTAAGAACGGTAGTAAATTAATTACAACTAGTGAACTGAACCAGAT
GAGTAAAACTGCAATTAGTCAAACCAGGTTTAACAAACTTAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy