Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-1 IGR149 IGR148 IGR146 IGR145 IGR147 IGR144 IGR150 MG199 hrcA, - MG205 MG202 rplT,rpL20, - MG198 grpE, - MG201 uvrC, - MG206 dnaJ_3, - MG200 parE, - MG203 parC, - MG204 MG199 hrcA, - MG205 MG202 rplT,rpL20, - MG198 grpE, - MG201 uvrC, - MG206 dnaJ_3, - MG200 parE, - MG203 parC, - MG204 MG199 hrcA, - MG205 MG202 rplT,rpL20, - MG198 grpE, - MG201 uvrC, - MG206 dnaJ_3, - MG200 parE, - MG203 parC, - MG204
* Calculated from Protein Sequence

Gene ID: MG203

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
parE  

Definition:
DNA topoisomerase IV subunit B (gyrase B)

Gene Start:
240322

Gene Stop:
242220

Gene Length:
1899

Molecular Weight*:
71561

pI*:
9.77

Net Charge*:
14.99

EC:
5.99.1.3  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous enzymes

Comment:
Required for cell septation and decatenation of completed chromosomes into progeny.
(See Bailey, et al 1996 GENE 168:77-80)

See Prosite PDOC00160.

From Prosite:

DNA topoisomerase I (EC 5.99.1.2) is one of the two types of enzyme that catalyze the interconversion of topological DNA isomers. Type II topoisomerases are ATP-dependent and act by passing a DNA segment through a transient double-strand break. Topoisomerase II is found in phages, archaebacteria, prokaryotes, eukaryotes, and in African Swine Fever virus (ASF). In bacteriophage T4 topoisomerase II consists of three subunits (the product of genes 39, 52 and 60). In prokaryotes and in archaebacteria the enzyme, known as DNA gyrase, consists of two subunits (genes gyrA and gyrB). In some bacteria, a second type II topoisomerase has been identified; it is known as topoisomerase IV and is required for chromosome segregation, it also consists of two subunits (genes parC and parE). In eukaryotes, type II topoisomerase is a homodimer.

See MG204, a predicted parC sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to gyrase B sequences , e.g. residues 1-633 are
69% similar to PARE_MYCPN.
MG203 is similar to T.pallidum TP1006, a predicted DNA gyrase B
sequence.It is also similar to the C.trachomatis gyrase B sequences
CT190 and CT661.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0187 is ehgpc-y.
COG name: DNA gyrase (topoisomerase II) B subunit.
Functional Class: L
BeTs to h,g,c,y


Blocks Summary:  Blocks Search
Residues 16-593 represent 11 matches to blocks BL00177A-H
(DNA topoisomerase II proteins).
Residues 66-80, 313-326 are matched to blocks PR00344A,D,
concerned with Bacterial sensor protein C-terminal signatures, e.g. DCTB_RHILE.
Residues 483-499 are matched to blocks PR00760A, concerned with
Bontoxilysin signatures, e.g. BXC1_CLOBO.

ProDom Summary:  Protein Domain Search
Residues 5-43, 44-180, 220-251, 252-482, 491-560, 563-578,
598-626 constitute defined domains of PARE_MYCGE.

Paralogs:  Local Blast Search
MG203 is paralogously related to MG003, also thought to be a gyrase B
sequence: residues 5-633 are 45% similar to residues 10-647 of MG003.

Pfam Summary:  Pfam Search
Residues 30 to 174 (E-value = 1.6e-30) place MG203 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 220 to 391 (E-value = 1.3e-68) place MG203 in the DNA_gyraseB family which is described as DNA gyrase B (PF00204)
Residues 419 to 531 (E-value = 7.1e-06) place MG203 in the Toprim family which is described as Toprim domain (PF01751)
Residues 558 to 624 (E-value = 4e-41) place MG203 in the DNA_gyraseB_C family which is described as DNA gyrase B subunit, carboxyl terminus (PF00986)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
131  
277
coil-coil  
358  
394
non-globular  
443  
515

PDB Hit:
gi|3212436|pdb|1AJ6| Novobiocin-Resistant Mutant (R136h) Of The N-Terminal 24 Kda Fragment Of Dna Gyrase B Complexed With Novobiocin At 2.3 Angstroms Resolution Topoisomerase, Gyrase, Novobiocin, Antibiotic, Resistant Mutant Mol_id: 1; Molecule: Gyrase;

Gene Protein Sequence:
MKSNYSATNIKILKGLDAVKKRPGMYIGSTDSKGLHHMLWEILANSVDEV
LAGYATNITVTLDLNNTITVSDDGRGIPYEIHQDSNISTIDTVFTFLHAG
GKFDDQSYKLAGGLHGVGASVVNALSDHLEVTVKRNGQIYQSVYQAGGKI
IQKAKKIGDTTSHGTTVSFHADPKVFKKAQFDSNIIKSRLKELSFLFAKL
KLTFTDQKTNKTTVFFSTSGLVQFLDEINNTVETLGQKTLIKGEKDGIEV
EVVFQFNQSDQETILSFANSIKTFEGGSHENGFCLAISDVINSYCRKYNL
LKEKDKNFQLSEIRQGLNAIIKVNLPEKNIAFEGQTKSKLFSKEVKNVVY
ELVQQHYFQFLERNNNDAKLIIDKLLNARKIKEQIKQQRELKKSLSSPQK
EKILFGKLAPCQTKKTSEKELFIVEGDSAGGTAKMGRDRIFQAILPLRGK
VLNVEKINNKKEAITNEEILTLIFCIGTGILTNFNIKDLKYGKIIIMTDA
DNDGAHIQILLLTFFYRYMQPLIELGHVYLALPPLYKLETKDRKTVKYLW
SDLELESVKLKLNNFTLQRYKGLGEMNADQLWDTTMNPTTRKLVQVKLDD
LINAEKQINIFMGEKSDLRKHWIEANINFSVEN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGTAACTACAGTGCAACTAACATCAAGATCTTAAAGGGTTTGGA
TGCAGTTAAAAAGCGTCCGGGGATGTACATTGGTTCTACTGATAGTAAGG
GTCTGCACCACATGCTATGGGAAATTCTTGCTAACAGTGTTGATGAAGTT
TTAGCTGGTTATGCAACCAATATTACTGTTACTTTAGATCTCAACAACAC
CATTACTGTTAGTGATGATGGCAGGGGTATTCCCTATGAGATCCACCAAG
ACAGTAACATCTCTACGATCGATACAGTTTTCACCTTTCTCCATGCAGGG
GGGAAGTTTGATGATCAGTCATACAAACTAGCAGGGGGATTACATGGGGT
TGGTGCATCAGTGGTCAATGCCTTAAGTGATCATTTAGAAGTAACAGTGA
AAAGAAATGGTCAGATCTACCAATCAGTTTATCAAGCTGGGGGTAAGATC
ATCCAAAAAGCCAAAAAGATTGGTGATACAACTAGCCATGGTACCACTGT
TAGTTTCCATGCTGACCCTAAGGTCTTTAAAAAGGCTCAATTTGATAGCA
ACATTATTAAAAGCAGGTTAAAAGAGCTAAGCTTTCTGTTTGCTAAACTA
AAGCTCACTTTTACTGATCAAAAAACTAATAAAACCACTGTTTTTTTTAG
TACCTCAGGACTAGTTCAGTTCCTTGATGAAATTAATAATACTGTAGAAA
CACTTGGCCAAAAAACACTGATTAAAGGTGAGAAGGATGGGATTGAAGTG
GAAGTGGTTTTCCAGTTTAACCAATCAGATCAAGAGACAATCTTATCATT
TGCTAACTCGATTAAAACCTTTGAAGGAGGGAGTCATGAAAATGGGTTTT
GTCTTGCCATTAGTGATGTGATCAACAGCTATTGCAGAAAGTACAACTTA
CTAAAAGAAAAAGATAAAAACTTTCAACTTAGTGAGATCAGACAAGGGTT
GAATGCTATTATCAAAGTTAACTTACCTGAAAAAAACATCGCTTTTGAAG
GACAAACTAAGAGTAAGTTGTTTTCAAAGGAAGTGAAAAACGTTGTTTAT
GAATTGGTCCAACAACACTATTTCCAGTTTCTGGAAAGAAACAACAATGA
TGCTAAATTGATCATTGATAAACTACTCAATGCTAGAAAGATTAAAGAGC
AAATCAAACAACAACGTGAGTTGAAAAAAAGTTTATCAAGTCCCCAAAAA
GAGAAGATCTTATTTGGGAAGTTAGCACCTTGTCAAACCAAAAAAACCAG
TGAAAAAGAGTTGTTTATTGTTGAAGGTGATAGTGCTGGTGGCACTGCTA
AAATGGGCCGTGATAGAATTTTTCAAGCTATCTTACCTTTGCGCGGCAAG
GTGTTAAATGTTGAAAAAATTAACAATAAGAAGGAAGCGATCACTAACGA
AGAGATCCTCACTTTAATCTTTTGTATTGGTACAGGGATTTTAACTAACT
TCAACATCAAGGACTTAAAGTACGGAAAGATCATCATTATGACTGATGCA
GATAATGATGGCGCACACATCCAAATCCTCTTACTTACCTTCTTTTATAG
GTACATGCAACCCTTAATTGAACTGGGCCATGTCTATCTAGCTCTTCCTC
CTTTATATAAACTGGAAACCAAAGATAGAAAAACAGTTAAATACCTCTGG
AGTGATTTGGAGTTGGAATCAGTCAAACTAAAGCTTAATAACTTCACTTT
ACAACGATACAAAGGACTTGGAGAGATGAATGCTGATCAGTTGTGAGATA
CTACTATGAATCCAACTACCAGAAAGCTAGTGCAAGTAAAGCTTGATGAT
CTAATTAACGCTGAAAAGCAAATCAACATCTTTATGGGTGAAAAGAGTGA
TTTGCGCAAACACTGGATTGAAGCCAACATTAACTTTAGTGTGGAAAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy