Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR143 IGR142 IGR140 IGR145 IGR141 IGR144 IGR139 MG199 rpL35,rmpI, - MG197 rplT,rpL20, - MG198 infC, - MG196 grpE, - MG201 pheS, - MG194 dnaJ_3, - MG200 pheT, - MG195 MG199 rpL35,rmpI, - MG197 rplT,rpL20, - MG198 infC, - MG196 grpE, - MG201 pheS, - MG194 dnaJ_3, - MG200 pheT, - MG195 Type: direct, Name:  - 21 Type: direct, Name:  - 34 Type: inverted, Name:  - 52 MG199 rplT,rpL20, - MG198 infC, - MG196 grpE, - MG201 pheS, - MG194 dnaJ_3, - MG200 pheT, - MG195 rpL35,rmpI, - MG197
* Calculated from Protein Sequence

Gene ID: MG195

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pheT  

Definition:
phenylalanyl-tRNA synthetase beta chain

Gene Start:
233036

Gene Stop:
235453

Gene Length:
2418

Molecular Weight*:
92127

pI*:
9.32

Net Charge*:
16.42

EC:
6.1.1.20  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
In B.subtilis, the phe-tRNA synthetase is a tetramer composed of two alpha and two beta subunits.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to other phenylalanyl-tRNA synthetase beta chain proteins. For example
residues 1-806 are 56% similar to SYFB_MYCPN phenylalanyl-tRNA synthetase
beta chain of Mycoplasma pneumoniae,(AE000006). Residues 1-763 are
22% similar to SYFB_BACSU, phenylalanine--tRNA ligase beta chain of
Bacillus subtilis,(X53057).
In addition residues 11-787 are 22% similar to CT475, phenylalanine-tRNA
synthase beta chain of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0072 is ehgpcmy.
COG name: Phenylanyl-tRNA synthetase beta subunit.
Functional Class: J
This domain spans most of MG195 starting at aa 150 and ending
at the C-terminus.
BeTs to -g--cmy.

The phylogenetic pattern of COG0073 is ehgpcmy.
COG name: EMAP domain
Functional Class: J
This domain starts at the N-terminus and ends at aa 149.


Blocks Summary:  Blocks Search
Residues 732-744 and 538-550 represent significant (95%) hits to block
BL00118A, Phospholipase A2 histidine proteins.

ProDom Summary:  Protein Domain Search
Residues 1-242, 243-370, 289-699, 371-509, and 510-586 constitute defined
domains of SYFB_MYCGE. Residues 289-699 are 22% similar to Phenylanyl-tRNA
synthetase alpha subunit as represented by SYFA_YEAST.

Paralogs:  Local Blast Search
This protein is paralogously related to MG449, M. genitalium predicted
coding region MG449. Residues 48-131 are 27% similar to MG449.

Pfam Summary:  Pfam Search
Residues 46 to 146 (E-value = 5.2e-06) place MG195 in the tRNA_bind family which is described as Putative tRNA binding domain (PF01588)
Residues 165 to 308 (E-value = 7.8e-56) place MG195 in the B3_4 family which is described as B3/4 domain (PF03483)
Residues 415 to 482 (E-value = 1.6e-18) place MG195 in the B5 family which is described as tRNA synthetase B5 domain (PF03484)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
48  
125
coil-coil  
673  
708

PDB Hit:
gi|2781286|pdb|1PYS|B Chain B, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Phenylalanyl-Trna Synthetase, Class Ii Aminoacyl-Trna Synthetase, Thermus Thermophilus, Rbd Domain, Sh3 Domain, Helix-Turn-Helix Motif Mol_id: 1; Molecule: Phenylalanyl-

Gene Protein Sequence:
MLISKKTLGVLIPDIFSFSNDQIAQKLEQMGIEVESIKQFNSPDYLQLAK
VVSIQPHPHDNKLFICELQIDKNKFINVVSNANNINNPDNINKFVIVAKK
GTELLNGLIVKTQNIKGIISEGILCSYIDINPFSRQIIEKTEVADAIIID
HVSNDHDWNQYLSFLSLDDVIFDVKTPTNRADLHSLIFLAKELGVLLKTK
TFLKQKSSVVNHDFFKFPLNLKNKLKANYFGGLFLRQINQHSSPWTVKGL
LINQMIKPVNYYVDKANLVTVFTAQPIHCHDADRIVGNIELKQATHNETF
VGLDDKQYEIEPGDIVVCDEKGIIALVGIIGSKRTMVQPTTTNIFFEVVN
CNSETIKQTAKRFLINNFASKFMVKPISLLATDNCLNYLQNSLLTTDNIG
KISHFSSSLKVEPFSKKLTVNFHKIRQLIGIEKKELTDQTIKKSLSQLGF
KVDNQLLKIPSYRQDINTWQDISEEIVKLIDINKLKPIGITSSFNFEKSS
YFNTFNALTKLRKKLQTLGFHNVITYQLTDQKSAKTFNLFNLENFITIKN
PVSQNHSVMRVSLIDSLLKVLKTNNNYKNELVNIFEFSFIKTQNNSELHL
AVLWVEKLFTSSFNPMQGISNDVFTMKGLAKLIVANLGFSCDFEPLDDSD
YFVNNQSLKIVVFNEQIGFIGLIKESLLNNYDLNNKPIYCLEINLDRMLS
SLNRIEKNYLGYSKLQPVCKDLTFSFTNPASHFDQFANMIKRITGIESWK
LISVFETMQNNQLITKYTVRYFLKNDANKPLTNQTIELITNNLKLQCEKL
KIKLDI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGATATCAAAAAAAACACTTGGCGTTTTAATCCCTGACATCTTTAG
TTTTTCTAATGATCAAATTGCCCAAAAGTTAGAACAAATGGGGATTGAAG
TGGAATCAATTAAGCAGTTTAACAGCCCTGATTACCTCCAACTTGCAAAG
GTTGTATCAATCCAACCCCATCCCCATGACAACAAGCTTTTTATCTGTGA
ATTACAAATTGATAAAAACAAGTTTATTAATGTTGTTTCCAATGCTAATA
ACATTAACAATCCTGATAATATCAACAAGTTTGTCATTGTTGCAAAAAAA
GGAACTGAGTTACTCAACGGGTTAATTGTTAAAACCCAAAATATTAAAGG
GATCATTTCAGAAGGGATTTTATGTAGCTATATTGACATTAACCCCTTCA
GTAGACAGATCATTGAAAAAACAGAAGTTGCTGATGCGATTATCATTGAT
CATGTTAGCAATGATCATGACTGAAACCAATACCTCTCGTTTTTAAGTTT
GGATGATGTGATCTTTGATGTTAAAACCCCAACTAACAGAGCAGATCTTC
ATAGCTTAATCTTTTTAGCAAAAGAACTTGGGGTACTTTTGAAAACCAAA
ACCTTTTTAAAACAAAAAAGTAGTGTTGTTAACCATGACTTTTTTAAGTT
TCCCCTAAATTTAAAAAACAAGTTAAAAGCGAATTATTTTGGCGGTTTGT
TCTTAAGACAAATTAACCAACATAGTTCACCTTGAACAGTTAAAGGACTG
TTAATTAACCAAATGATCAAACCAGTTAACTATTATGTTGATAAAGCTAA
CTTAGTAACAGTGTTCACCGCTCAGCCAATCCATTGTCATGATGCAGATA
GAATTGTTGGTAACATTGAACTTAAACAAGCAACCCATAATGAAACTTTT
GTTGGACTTGATGACAAGCAATATGAGATTGAACCAGGGGATATTGTTGT
TTGTGATGAGAAGGGCATTATTGCACTGGTAGGGATCATTGGTTCAAAGC
GCACAATGGTCCAACCTACAACAACTAACATCTTTTTTGAAGTTGTTAAC
TGTAACAGTGAAACCATTAAACAAACTGCCAAGCGCTTTTTGATCAATAA
CTTTGCCAGTAAGTTTATGGTTAAACCGATTAGCTTATTAGCTACTGATA
ACTGTTTAAACTACTTACAAAACAGTTTACTAACCACTGATAACATTGGC
AAAATTAGCCACTTTTCAAGTTCGCTTAAAGTTGAACCATTTAGTAAAAA
GCTCACAGTGAATTTCCATAAGATACGCCAACTAATTGGCATTGAAAAAA
AGGAACTAACTGATCAAACCATTAAAAAAAGCCTCAGTCAACTAGGGTTT
AAAGTTGACAACCAACTTCTCAAAATCCCCAGTTACAGACAAGACATTAA
TACCTGACAAGACATTAGTGAAGAGATTGTGAAGTTAATTGATATCAATA
AGTTAAAACCAATTGGGATCACTAGTAGTTTTAACTTTGAAAAGTCCAGT
TACTTTAACACTTTTAATGCTTTAACAAAACTAAGAAAAAAGCTACAAAC
ACTTGGTTTTCACAACGTTATTACCTACCAGTTAACTGATCAAAAAAGTG
CAAAAACTTTTAATTTGTTTAACTTAGAAAATTTCATCACCATTAAAAAC
CCAGTGTCCCAAAACCATTCTGTAATGCGTGTTAGCTTAATTGATTCACT
GTTAAAAGTGCTAAAAACCAATAACAACTATAAGAATGAACTGGTGAACA
TCTTTGAGTTTTCCTTTATTAAAACCCAAAACAATAGTGAACTGCACCTG
GCAGTATTATGAGTTGAAAAACTGTTTACTTCTAGTTTCAATCCTATGCA
AGGGATAAGCAATGATGTTTTTACTATGAAGGGATTAGCAAAACTCATTG
TTGCTAACTTAGGGTTTAGTTGTGACTTTGAACCACTTGATGATAGTGAC
TATTTTGTTAATAATCAAAGTTTAAAAATAGTAGTTTTTAACGAACAGAT
CGGTTTTATTGGGCTAATTAAAGAATCATTGTTAAATAACTATGATCTGA
ACAATAAACCCATTTATTGTCTTGAAATCAACTTAGATAGGATGCTCTCT
TCTCTAAACAGGATTGAAAAAAACTACCTTGGTTACAGTAAACTACAACC
TGTTTGCAAGGATCTTACCTTTAGTTTTACCAACCCTGCTAGTCACTTTG
ATCAGTTTGCTAACATGATCAAAAGGATAACTGGCATTGAAAGTTGAAAG
TTAATTAGTGTCTTTGAAACTATGCAAAACAACCAACTGATCACTAAGTA
CACCGTTCGTTATTTTCTGAAAAATGATGCTAACAAACCACTAACTAACC
AAACAATTGAACTTATCACTAATAACTTAAAACTCCAGTGTGAAAAACTA
AAAATTAAATTAGATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy