Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR143 IGR142 IGR140 IGR141 IGR144 IGR139 MG199 rpL35,rmpI, - MG197 rplT,rpL20, - MG198 infC, - MG196 pheS, - MG194 dnaJ_3, - MG200 pheT, - MG195 mgpC, - MG192 MG199 rpL35,rmpI, - MG197 rplT,rpL20, - MG198 infC, - MG196 pheS, - MG194 dnaJ_3, - MG200 pheT, - MG195 mgpC, - MG192 Type: direct, Name:  - 21 Type: direct, Name:  - 34 Type: inverted, Name:  - 52 MG199 rplT,rpL20, - MG198 infC, - MG196 pheS, - MG194 dnaJ_3, - MG200 pheT, - MG195 mgpC, - MG192 rpL35,rmpI, - MG197
* Calculated from Protein Sequence

Gene ID: MG194

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pheS  

Definition:
phenylalanyl-tRNA synthetase alpha-subunit

Gene Start:
232007

Gene Stop:
233029

Gene Length:
1023

Molecular Weight*:
38969

pI*:
8.23

Net Charge*:
4.64

EC:
6.1.1.20  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
The phenylalanyl-tRNA synthetase is typically a heteroterameric molecule consisting of two alpha and two beta chains.

Reaction:
ATP + L-PHENYLALANINE + TRNA(PHE) =
AMP + PYROPHOSPHATE + L-PHENYLALANYL-TRNA(PHE).

See MG195, phenylalanyl-tRNA synthetase beta-subunit

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to other phenylalanine tRNA ligase alpha chain proteins. For example
residues 1-341 are 65% similar to SYFA_MYCPN, phenylalanyl-tRNA
synthetase alpha-subunit of Mycoplasma pneumoniae,(AE000006). Residues
38-339 are 37% similar to SYFA_BACSU, phenylalanyl-tRNA synthetase
alpha subunit of Bacillus subtilis,(Z99118).
In addition residues 162-329 are 26% similar to TP0973, phenylalanyl-tRNA
synthetase alpha subunit of T. pallidum and residues 49-340 are 35%
similar to CT836, phenylalanyl-tRNA synthetase alpha subunit of C.
trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0016 is ehgpcmy.
COG name: Phenylalanyl-tRNA synthetase alpha subunit.
Functional Class: J
BeTs to -hg-cmy.

Blocks Summary:  Blocks Search
Residues 108-117 and 254-266 represent significant (97%) hits to blocks
PR00221D,G, CAULIMOVIRUS COAT PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 1-87, 104-129, 130-295, and 296-339 constitute defined domains
of SYFA_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 105 to 326 (E-value = 4.4e-119) place MG194 in the tRNA-synt_2d family which is described as tRNA synthetases class II core domain (F) (PF01409)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
76

PDB Hit:
gi|2781285|pdb|1PYS|A Chain A, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Phenylalanyl-Trna Synthetase, Class Ii Aminoacyl-Trna Synthetase, Thermus Thermophilus, Rbd Domain, Sh3 Domain, Helix-Turn-Helix Motif Mol_id: 1; Molecule: Phenylalanyl-

Gene Protein Sequence:
MIDQNKLITKWKKAFAKAKNLTTLVNLKNTLHNSDLKPLLQKIKTATKLS
EKSSLGKLYQSLDIQLTDLLTSYKKTFEINNQVSQKPSLDVMLPATEFTN
GSNNALYQVIDNLVEYFKSFLFTINFDSELTSISDCFDLLNIPKDHSSRN
ESDSFYIDKTSLLRTHCTATTLKAVRTSKKTNNPDIRVVSLGAVFRNDSD
DATHSHQFTQLDFMWIKKGLSLANLKWFINNMITHFFGENTFTRFRLSHF
PFTEPSFEIDIRCWLCQNGCSICKQTKWIEILGAGIIHPQVMNNMGIGDT
ENITGIAAGIGIERLAMLKYGIDDIRDFYDNNFKFLTQFTD

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGATCAAAACAAGTTAATTACTAAGTGAAAAAAAGCATTTGCAAA
AGCTAAGAATTTAACTACTTTAGTTAATCTTAAGAACACTTTACACAACA
GTGATTTAAAGCCATTACTCCAAAAGATTAAAACCGCTACAAAACTAAGT
GAAAAAAGTAGTTTAGGTAAGCTTTATCAATCACTTGATATTCAACTAAC
TGATCTGTTAACTAGTTACAAAAAAACCTTTGAAATAAATAACCAAGTTA
GTCAAAAACCTTCACTTGATGTGATGCTACCAGCAACAGAGTTTACCAAT
GGTTCTAATAACGCACTATATCAGGTTATTGATAATTTAGTTGAATACTT
TAAAAGCTTTTTATTCACAATTAATTTTGATAGTGAACTGACCAGTATTA
GTGACTGTTTTGATCTTTTAAATATCCCTAAAGATCATTCCAGTAGGAAT
GAATCTGATTCTTTTTATATCGATAAAACCAGTTTATTGAGAACCCATTG
TACTGCTACCACGCTAAAAGCAGTCAGAACTTCTAAAAAAACTAATAATC
CTGATATCAGGGTTGTCTCTTTAGGAGCGGTTTTTCGTAATGATAGTGAT
GATGCCACCCACTCCCATCAGTTTACCCAACTTGATTTTATGTGGATTAA
AAAAGGGCTTTCATTAGCTAATTTAAAGTGGTTTATTAACAATATGATCA
CCCATTTCTTTGGGGAAAATACTTTTACTAGGTTTAGACTATCCCACTTC
CCATTCACTGAACCCTCGTTTGAAATTGACATTAGGTGTTGGTTATGTCA
AAATGGTTGTTCTATTTGTAAGCAAACCAAGTGAATTGAGATCTTAGGGG
CGGGGATCATCCATCCCCAGGTGATGAATAACATGGGAATTGGGGATACT
GAAAATATTACTGGGATAGCAGCAGGAATTGGGATTGAACGCTTAGCAAT
GTTAAAGTATGGGATTGATGATATCCGTGATTTTTATGATAACAACTTTA
AGTTTTTAACCCAGTTTACTGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy