Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR132 IGR133 IGR134 mte1, - MG184 MG181 pepF, - MG183 MG185 mte1, - MG184 MG181 pepF, - MG183 MG185 Type: direct, Name:  - 47 Type: direct, Name:  - 22 Type: direct, Name:  - 31 Type: direct, Name:  - 33 mte1, - MG184 MG181 pepF, - MG183 MG185 hisT, - MG182 MG180 hisT, - MG182 MG180
* Calculated from Protein Sequence

Gene ID: MG184

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mte1  

Definition:
adenine-specific DNA modification methylase

Gene Start:
210392

Gene Stop:
211342

Gene Length:
951

Molecular Weight*:
37008

pI*:
10.20

Net Charge*:
17.15

EC:
2.1.1.72  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous enzymes

Comment:
This methylase recognizes the double-stranded sequence GAATTC and
causes specific methylation of the #3 A on both strands. It also
protects the DNA from cleavage by the EcoRI endonuclease.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to methyltransferases with the most common being to adenine-specific
methyltransferases. For example residues 1-316 are 58% similar to
Y184_MYCPN, adenine specific DNA modification methylase of Mycoplasma
pneumoniae,(AE000061). Residues 5-317 are 36% similar to MTE1_ECOLI,
methyltransferase of E. coli.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 111-119 represents a significant (97%) hit to block BL00092,
N-6 Adenine-specific DNA methylases proteins. Residues 111-120
represents a significant (95%) hit to block BL01261C, Uncharacterized
protein family UPF0020 proteins.

ProDom Summary:  Protein Domain Search
Residues 5-317 constitute a defined domain of Y184_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
127

PDB Hit:


Gene Protein Sequence:
VHHFNRAKKAKNNEFFTLIDEIENEVINYQKQFANKTIFCNCNDGKNSHF
FQFFQTNFNQLQLKKLIGFSFNNLSQADKFTFDGNKVTKTKLKGNGDFSS
DESIEVLKQADIVVTNPPFSLFQSFIDLLIQHNKQFLVLGLNAAVSYNHI
FTYFKTNKLWFGYTVNKTMSFSVNSDYQLYNPKTSNFFTKNGKCFQKIAG
ISWFTNLGKPHYNPFLNTNCFYKNNEKNYPKFDWYDAIYVNKIKNIPMDW
NGLMGVPLTFLNCYNPKQFELVDCLANPYATLDTLKTNAFVKLNQGDVRN
VNGKRRYVRVIIKKQQI

Gene Nucleotide Sequence:  Sequence Viewer
GTGCACCATTTTAACCGCGCTAAAAAGGCCAAGAATAACGAGTTTTTTAC
TTTAATTGATGAGATTGAAAACGAAGTAATTAACTACCAAAAGCAGTTTG
CAAATAAAACCATTTTTTGTAACTGTAATGATGGTAAAAATTCCCATTTT
TTTCAGTTTTTTCAAACTAACTTTAACCAGTTACAACTAAAAAAACTCAT
TGGGTTTAGTTTTAATAATCTCTCACAAGCTGACAAGTTCACTTTTGATG
GAAATAAAGTAACTAAAACCAAATTAAAGGGTAATGGTGATTTTAGTTCT
GATGAATCGATTGAAGTGTTAAAACAAGCAGATATAGTTGTAACAAATCC
ACCCTTTAGTTTGTTTCAAAGTTTCATTGATCTGTTAATACAACACAACA
AGCAGTTTCTGGTTTTAGGGTTAAATGCAGCAGTTAGCTATAACCATATT
TTTACCTACTTTAAAACTAACAAGTTGTGGTTTGGCTATACCGTTAATAA
AACAATGAGTTTTTCAGTTAACAGTGACTATCAACTTTATAACCCCAAAA
CTAGTAACTTTTTTACAAAAAATGGCAAGTGTTTCCAAAAGATAGCAGGT
ATCTCTTGGTTTACTAATTTAGGAAAACCACATTATAACCCCTTTTTAAA
TACCAACTGTTTTTATAAAAACAACGAAAAAAACTATCCCAAGTTTGATT
GGTATGATGCTATTTATGTCAACAAGATTAAAAACATCCCTATGGATTGA
AATGGATTGATGGGAGTTCCTTTAACCTTTTTAAACTGTTACAACCCCAA
GCAGTTTGAATTAGTTGATTGTCTTGCTAACCCTTATGCTACCTTAGATA
CATTAAAAACAAATGCCTTTGTGAAATTAAATCAGGGTGATGTGAGAAAT
GTTAATGGTAAAAGAAGGTATGTAAGGGTAATAATTAAAAAACAACAAAT
T


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy