Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR130 IGR129 IGR127 IGR125 IGR126 IGR124 IGR128 IGR131 rpmJ,rpL36, - MG174 infA, - MG173 rpsM,rpS13, - MG175 rpL15,rpl0, - MG169 rpsE,rpS5, - MG168 map, - MG172 MG179 rpoA, - MG177 MG181 secY, - MG170 pepF, - MG183 rpmJ,rpL36, - MG174 infA, - MG173 rpsM,rpS13, - MG175 rpL15,rpl0, - MG169 rpsE,rpS5, - MG168 map, - MG172 MG179 rpoA, - MG177 MG181 secY, - MG170 pepF, - MG183 infA, - MG173 rpsE,rpS5, - MG168 map, - MG172 MG179 rpoA, - MG177 MG181 secY, - MG170 pepF, - MG183 rplQ,rpL17, - MG178 rpsK,rpS11, - MG176 adk, - MG171 hisT, - MG182 MG180 rplQ,rpL17, - MG178 adk, - MG171 hisT, - MG182 MG180 rpsM,rpS13, - MG175 rpL15,rpl0, - MG169 rpsK,rpS11, - MG176 rpmJ,rpL36, - MG174
* Calculated from Protein Sequence

Gene ID: MG177

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoA  

Definition:
DNA-directed RNA polymerase alpha chain

Gene Start:
203516

Gene Stop:
204499

Gene Length:
984

Molecular Weight*:
36877

pI*:
8.17

Net Charge*:
2.80

EC:
2.7.7.6  

Functional Class:
Transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphate substrates.

Reference: Eur J Biochem. 1981 Jun 1;116(3):621-9.

See MG022, a predicted rpoE sequence; MG054, a predicted nusG sequence; MG141, a predicted nusA sequence; MG249, a predicted rpoD sequence; MG340, a predicted rpoC sequence; and MG341, a predicted rpoB sequence.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to DNA-dependent RNA polymerase proteins. For example residues 1-328
are 85% similar to RPOA_MYCPN, DNA-directed RNA polymerase alpha chain
of Mycoplasma pneumoniae,(AE000061). Residues 23-327 are 38% similar
to RPOA_BACSU, DNA-directed RNA polymerase alpha chain of Bacillus
subtilis.
In addition residues 18-325 are 33% similar to TP0212, DNA-directed
RNA polymerase, alpha subunit and residues 26-325 are 28% similar to
CT507, RNA polymerase alpha subunit.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0202 is ehgpcmy.
COG name: DNA-dependent RNA polymerase alpha subunit.
Functional Class: K
BeTs to -hg-c--.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 25-320 constitute a defined domain of RPOA_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 17 to 242 (E-value = 1.3e-16) place MG177 in the RNA_pol_L family which is described as RNA polymerase Rpb3/Rpb11 dimerisation domain (PF01193)
Residues 59 to 187 (E-value = 1.8e-45) place MG177 in the RNA_pol_A_bac family which is described as RNA polymerase Rpb3/RpoA insert domain (PF01000)
Residues 254 to 321 (E-value = 9.8e-36) place MG177 in the RNA_pol_A_CTD family which is described as Bacterial RNA polymerase, alpha chain C terminal domain (PF03118)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
36  
63
transmembrane  
217  
242
coil-coil  
243  
275

PDB Hit:
gi|1421046|pdb|1COO| The Cooh-Terminal Domain Of Rna Polymerase Alpha Subunit Transcription Regulation Mol_id: 1; Molecule: Rna Polymerase Alpha Subunit; Chain: Null; Fragment: Cooh-Terminal Domain; Engineered: Yes

Gene Protein Sequence:
MEKFLKYEIKVNNNQPTNTNPNYGIFEVAPLESGFGITIGNAMRRVLLSC
IPGASVFAIAISGVKQEFSNVEGVLEDVTEMVLNFKQLVVRISDLLFEDG
EMIEPPLERWPVLKVTAEKKGAVYAKDLECPAGFEVINKDLYLFSLQKDM
KLTVSVYVKQGRGFTSFLENRELINSLGIIATDANFSPVLHCGYEVQEVK
TSKQKLTDHLTFKIATNGAIKAVDAFAMAAKILIEHLNPIVSVNESIKNL
TIIQEKAEERKVKSFAKQIEELDFTVRTFNCLKRSGIHTLQELLSKSLTD
IREIRNLGKKSEREIIKKVQELGLKFRS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAATTTTTAAAGTACGAAATTAAGGTTAACAACAACCAACCAAC
CAACACTAACCCTAACTATGGGATCTTTGAAGTAGCACCGTTAGAATCAG
GATTTGGGATTACCATTGGTAATGCGATGCGCCGAGTGTTACTTAGTTGT
ATCCCAGGCGCTAGTGTGTTTGCCATTGCCATTAGTGGGGTAAAACAAGA
GTTTAGTAATGTGGAGGGTGTGTTGGAAGATGTGACTGAAATGGTGTTAA
ACTTCAAGCAACTAGTGGTGAGAATCTCTGATCTTTTGTTTGAAGATGGG
GAGATGATCGAACCACCCTTAGAAAGGTGACCAGTTTTAAAAGTTACTGC
TGAAAAAAAGGGTGCAGTATATGCAAAGGATCTTGAGTGTCCAGCTGGTT
TTGAAGTGATTAATAAGGACCTTTATCTCTTCTCTTTACAAAAGGACATG
AAACTAACAGTCAGTGTTTATGTTAAACAGGGTAGGGGCTTTACTAGCTT
TCTTGAAAACAGAGAATTGATCAATTCGCTTGGCATTATTGCTACAGATG
CTAACTTTTCCCCGGTTTTACACTGTGGTTATGAAGTTCAAGAGGTGAAA
ACTTCCAAACAAAAGTTAACTGACCATCTCACCTTTAAGATTGCTACTAA
CGGTGCAATTAAAGCAGTGGATGCGTTTGCTATGGCAGCAAAGATCCTAA
TTGAACACTTAAACCCAATTGTAAGTGTCAATGAGTCAATTAAGAATTTA
ACAATTATCCAAGAGAAAGCAGAGGAAAGAAAGGTGAAATCATTTGCCAA
GCAAATTGAAGAACTTGACTTTACTGTTAGAACCTTTAACTGTTTGAAAA
GAAGTGGGATCCACACACTCCAAGAGTTACTATCAAAGTCATTAACTGAC
ATTAGAGAGATTAGAAACCTAGGTAAGAAATCAGAACGGGAGATTATCAA
AAAGGTGCAAGAGTTAGGTTTAAAATTCCGTTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy