Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR130 IGR129 IGR127 IGR125 IGR122 IGR126 IGR123 IGR124 IGR121 IGR128 IGR131 rpmJ,rpL36, - MG174 infA, - MG173 rplR,rpL18, - MG167 rpsM,rpS13, - MG175 rpsH,rpS8, - MG165 rpL15,rpl0, - MG169 rplF,rpL6, - MG166 rpsE,rpS5, - MG168 map, - MG172 MG179 rpoA, - MG177 MG181 secY, - MG170 rpmJ,rpL36, - MG174 infA, - MG173 rplR,rpL18, - MG167 rpsM,rpS13, - MG175 rpsH,rpS8, - MG165 rpL15,rpl0, - MG169 rplF,rpL6, - MG166 rpsE,rpS5, - MG168 map, - MG172 MG179 rpoA, - MG177 MG181 secY, - MG170 infA, - MG173 rplR,rpL18, - MG167 rpsM,rpS13, - MG175 rpsH,rpS8, - MG165 rpL15,rpl0, - MG169 rplF,rpL6, - MG166 rpsE,rpS5, - MG168 map, - MG172 MG179 rpoA, - MG177 secY, - MG170 rpsN,rpS14, - MG164 rplQ,rpL17, - MG178 rpsK,rpS11, - MG176 adk, - MG171 MG180 rplQ,rpL17, - MG178 adk, - MG171 MG180 MG181 rpsN,rpS14, - MG164 rpsK,rpS11, - MG176 rpmJ,rpL36, - MG174
* Calculated from Protein Sequence

Gene ID: MG172

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
map  

Definition:
methionine aminopeptidase

Gene Start:
201680

Gene Stop:
202423

Gene Length:
744

Molecular Weight*:
27724

pI*:
7.08

Net Charge*:
0.30

EC:
3.4.11.18  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Miscellaneous enzymes

Comment:
See Prosite PDOC00417 and PDOC00575.

From Prosite:

Methionine aminopeptidase (EC 3.4.11.18) (MAP) is responsible for the removal of the amino-terminal (initiator) methionine from nascent eukaryotic cytosolic and cytoplasmic prokaryotic proteins if the penultimate amino acid is small and uncharged. All MAP studied to date are monomeric proteins that require cobalt ions for activity.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to methionine aminopeptidase proteins. For example residues 1-248 are
65% similar to AMPM_MYCPN, methionine aminopeptidase of Mycoplasma
pneumoniae,(AE000061). Residues 1-247 are 36% similar to AMPM_BACSU,
methionine aminopeptidase of Bacillus subtilis,(Z99104).
In addition residues 1-247 are 29% similar to TP0842 methionine
aminopeptidase of T. pallidum and residues 2-247 are 24% similar to
CT851, methionine aminopeptidase of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0024 is ehgpcmy.
COG name: Methionine aminopeptidase.
Functional Class: J
BeTs to -hg-c-y.

Blocks Summary:  Blocks Search
Residues 2-41, 59-80, 85-113, 139-184, and 193-245 represent significant
(100%) hits to blocks BL00680A,B,C,D,E, Methionine aminopeptidase
subfamily 1 proteins. Residues 165-177, 193-207, and 172-185 represent
significant (98%) hits to blocks BL00491B,C,D, Aminopeptidase P and
proline dipeptidase proteins.

ProDom Summary:  Protein Domain Search
Residues 8-197 and 204-247 constitute defined domains of AMPM_MYCGE.

Paralogs:  Local Blast Search
This protein is paralogously related to MG324, XAA-pro aminopeptidase.
Residues 4-203 are 26% similar to MG324.

Pfam Summary:  Pfam Search
Residues 164 to 237 (E-value = 3.4e-25) place MG172 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

PDB Hit:
gi|494313|pdb|1MAT| Methionine Aminopeptidase (E.C.3.4.11.18)

Gene Protein Sequence:
MIYLKSANEVAGIKKACAIFKAVKAYFTIEKLLGKKLVTIDRLIKQFIEQ
KQAKCAFHGYLGFPGFNCLSLNQTVIHGVADQTVFKDSDKLTLDIGIDYH
GYLCDAAFTLLGNKADPKAVKLLNDVEQAFSKVIEPELFVNNPIGNLSNA
IQTYFENKGYFLVKEFGGHGCGIKIHEDPLILNWGEKNQGVRLQEGMVIC
IEPMVMTDSSEITMAANNWNVLTLKSKFNCHVEQMYHITNNGFECLTN

Gene Nucleotide Sequence:  Sequence Viewer
ATGATCTATCTCAAATCTGCAAATGAAGTTGCAGGGATTAAAAAAGCATG
TGCAATCTTCAAAGCAGTTAAGGCATATTTTACAATTGAAAAGTTACTTG
GCAAAAAGTTGGTTACCATTGATCGTTTAATCAAACAATTCATTGAACAA
AAACAAGCTAAATGTGCGTTTCATGGTTATCTAGGTTTCCCTGGTTTTAA
CTGTCTATCGTTAAACCAAACGGTTATCCATGGAGTTGCCGATCAAACTG
TTTTTAAAGATAGTGATAAACTAACGCTTGACATTGGGATAGACTATCAT
GGTTATCTTTGTGATGCAGCTTTCACTTTACTTGGTAATAAAGCTGATCC
AAAGGCAGTAAAACTGTTAAATGATGTTGAACAAGCATTTAGTAAGGTAA
TTGAACCTGAGCTATTTGTTAACAATCCGATTGGTAATTTATCCAATGCG
ATCCAAACTTACTTTGAAAACAAGGGCTATTTTCTTGTCAAAGAGTTTGG
GGGTCATGGTTGTGGGATTAAGATCCATGAAGATCCTTTAATCTTAAACT
GGGGAGAGAAAAACCAGGGCGTTAGGTTACAAGAGGGGATGGTAATCTGT
ATTGAACCGATGGTTATGACTGATAGTAGTGAGATAACAATGGCAGCTAA
CAACTGGAATGTACTAACTTTAAAGAGTAAGTTTAACTGTCATGTGGAAC
AGATGTATCACATCACAAACAACGGCTTTGAATGTTTAACTAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy