Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR125 IGR130 IGR129 IGR127 IGR122 IGR120 IGR126 IGR123 IGR124 IGR119 IGR121 IGR128 IGR131 rpmJ,rpL36, - MG174 infA, - MG173 rplX,rpL24, - MG162 rplR,rpL18, - MG167 rplQ,rpL17, - MG178 rpsM,rpS13, - MG175 rpsH,rpS8, - MG165 rpL15,rpl0, - MG169 rplE,rpL5, - MG163 rplF,rpL6, - MG166 rpsE,rpS5, - MG168 map, - MG172 MG180 rpoA, - MG177 secY, - MG170 rpmJ,rpL36, - MG174 infA, - MG173 rplX,rpL24, - MG162 rplR,rpL18, - MG167 rplQ,rpL17, - MG178 rpsM,rpS13, - MG175 rpsH,rpS8, - MG165 rpL15,rpl0, - MG169 rplE,rpL5, - MG163 rplF,rpL6, - MG166 rpsE,rpS5, - MG168 map, - MG172 MG180 rpoA, - MG177 secY, - MG170 infA, - MG173 rplR,rpL18, - MG167 rpsM,rpS13, - MG175 rpL15,rpl0, - MG169 rplE,rpL5, - MG163 rplF,rpL6, - MG166 rpsE,rpS5, - MG168 map, - MG172 MG180 rpoA, - MG177 secY, - MG170 rpsN,rpS14, - MG164 rpsK,rpS11, - MG176 adk, - MG171 MG179 adk, - MG171 MG179 rplQ,rpL17, - MG178 rpsH,rpS8, - MG165 rpsK,rpS11, - MG176 rpmJ,rpL36, - MG174 rplX,rpL24, - MG162 rpsN,rpS14, - MG164
* Calculated from Protein Sequence

Gene ID: MG171

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
adk  

Definition:
adenylate kinase

Gene Start:
201033

Gene Stop:
201674

Gene Length:
642

Molecular Weight*:
24234

pI*:
8.69

Net Charge*:
5.19

EC:
2.7.4.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Comment:
This enzyme is essential for maintence and cell growth.

See Prosite PDOC00104.

From Prosite: Adenylate kinase (EC 2.7.4.3) (AK) is a small monomeric enzyme that catalyzes the reversible transfer of MgATP to AMP (MgATP + AMP = MgADP + ADP).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to adenylate kinase proteins. For example residues 6-213 are 45%
similar to KAD_MYCPN, adenylate kinase of Mycoplasma pneumoniae,(AE000061).
Residues 9-213 are 34% similar to adenylate kinase of Archaeoglobus
fulgidus,(AE001058).
In addition residues 7-204 are 36% similar to TP0595, adenylate kinase
of T. pallidum and residues 9-209 are 33% similar to CT128, adenylate
kinase of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0563 is ehgpcmy.
COG name: Adenylate/cytidylate kinase.
Functional Class: F
BeTs to -hg-cmy.

Blocks Summary:  Blocks Search
Residues 9-41, 85-102, 158-191, 147-180, and 157-190 represent
significant (100%) hits to blocks BL00113A,B,C, Adenylate kinase
proteins. Residues 7-22 represent a significant (99%) hit to block
PR00819B, CBXX/CFQX SUPERFAMILY SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 8-117 and 156-187 constitute defined domains of KAD_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 10 to 192 (E-value = 4.9e-39) place MG171 in the ADK family which is described as Adenylate kinase (PF00406)
Residues 128 to 163 (E-value = 1.5e-16) place MG171 in the ADK_lid family which is described as Adenylate kinase, active site lid (PF05191)

PDB Hit:
gi|2392647|pdb|1ZIN| Adenylate Kinase With Bound Ap5a Phosphotransferase, Zinc Finger Mol_id: 1; Molecule: Adenylate Kinase; Chain: Null; Synonym: Adk; Ec: 2.7.4.3; Other_details: Zinc Finger

Gene Protein Sequence:
MVAQFNKFIILGPPGAGKGTVCKLLSKTTKLVHIASGDLFREAIKNQSVI
GRKIAAIISQGGYVDDATTNQLVYEYITTNPLPNGFILDGYPRTENQLDF
LNIKLTIDMVFELVVSDLNKLITRIDNRVICNNCNSVYNLLFQKPLVENS
CDQCSAKLVKRSDDNKAVVKARMELYQQTIQPIHTYFFNKQLLVQIDCFL
PLEEQLKTIKQFIR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAGCACAGTTTAATAAGTTCATTATCTTAGGACCCCCAGGGGCAGG
AAAAGGTACAGTTTGTAAACTGCTTAGCAAAACAACTAAGTTAGTCCATA
TTGCTAGTGGTGATCTGTTTAGAGAAGCCATTAAAAACCAGAGTGTTATT
GGTAGAAAGATTGCAGCAATTATCAGTCAGGGTGGTTATGTTGATGATGC
CACTACTAACCAGCTTGTTTATGAATATATCACTACCAATCCATTACCAA
ATGGTTTTATCTTAGATGGTTATCCAAGAACAGAGAACCAGCTTGATTTT
CTAAATATTAAACTAACCATTGACATGGTCTTTGAACTAGTTGTTAGTGA
TCTGAATAAACTGATTACACGGATTGATAACAGGGTTATTTGTAACAACT
GTAACAGTGTTTATAACTTGCTTTTTCAAAAACCACTAGTTGAAAATAGT
TGTGATCAGTGTTCAGCTAAACTAGTGAAAAGGAGTGATGATAACAAAGC
AGTGGTCAAAGCAAGAATGGAGTTATATCAACAAACAATTCAACCAATCC
ACACTTACTTTTTCAACAAACAACTTTTAGTACAAATTGATTGCTTTTTA
CCACTAGAAGAACAACTCAAGACAATCAAACAATTTATTAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy