Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR96 IGR92 IGR95 IGR97 IGR94 IGR93 IGR98 MG133 MG135 MG131 MG134 MG130 lysS, - MG136 MG139 lepA, - MG138 MG133 MG135 MG131 MG134 MG130 lysS, - MG136 MG139 lepA, - MG138 Type: direct, Name:  - 22 Type: direct, Name:  - 26 Type: inverted, Name:  - 63 MG133 MG135 MG132 MG132 MG134 MG130 lysS, - MG136 MG139 lepA, - MG138 glf, - MG137 glf, - MG137 MG131
* Calculated from Protein Sequence

Gene ID: MG137

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glf  

Definition:
UDP-galactopyranose mutase

Gene Start:
162376

Gene Stop:
163587

Gene Length:
1212

Molecular Weight*:
46617

pI*:
10.24

Net Charge*:
19.16

EC:
5.4.99.9  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Miscellaneous enzymes

Comment:
This protein is involved in lipopolysaccharide biosynthesis. Also
named dTDP-4-dehydrorhamnose reductase (rfbD).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to other UDP-galactopyranose mutase proteins, for example residues
9-403 are 61% similar to UDP-galactopyranose mutase of Mycoplasma
pneumoniae (AE000055). Residues 21-397 are 32% similar to
UDP-galactopyranose mutase of Methanobacterium thermoautotrophicum,
(AE000819). In addition, residues 22-55 are 47% similar to CT148,
a predicted monooxygenase of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0562 is .
COG name: Predicted FAD-utilizing enzymes, including geranylgeranyltransferase
regulatory subunits.
Functional Class: R
BeTs to e-g---y.

Blocks Summary:  Blocks Search
Residues 22-41 represent a significant (99%) hit to block PR00757A,
FLAVIN-CONTAINING AMINE OXIDASE SIGNATURE. Residues 22-44 and 365-383
represent blocks PR00420A,E, aromatic ring hydroxylase (flavoprotein momooxygenase) signature. Residues 22-44 and 45-58 represent significant
(98%) hits to blocks PR00419A,B, adrenodoxin reductase family signature.
Residues 22-40 represent a significant (97%) hit to block BL00623A,
GMC oxidoreductases proteins. Residues 24-55 represent a significant
(96%) hit to block BL00982A, Bacterial-type phytoene dehydrogenase
proteins.

ProDom Summary:  Protein Domain Search
Residues 21-404 constitute a defined domain of GLF_MYCGE. Residues
21-57 and 300-390 support weak hits to GDI1_YEAST.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 170 to 385 (E-value = 3.1e-148) place MG137 in the GLF family which is described as UDP-galactopyranose mutase (PF03275)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
19  
41

PDB Hit:


Gene Protein Sequence:
VNVILSVMLFSSPSCVNINSFDILIVGAGISGIVLANILANHNKRVLIVE
KRDHIGGNCYDKVDSKTQLLFHQYGPHIFHTNNQTVINFISPFFELNNYH
HRVGLKLKNNLDLTLPFDFQQIYKLMGKDGRKLVSFFKENFSLNTHLSLA
ELQLIDNPLAQKLYQFLISNVYKPYSVKMWGLPFAMINENVINRVKIVLS
EQSSYFPDAIIQGLPKSGYTNSFLKMLANPLIDVQLNCKDNLLVYQDEKL
FFNNNLIEKPVVYCGLIDKLFNFCFGHLQYRSLAFSWKRFNQKKYQTYPV
VNMPLAKSITRSVEYKQLTNQGSFKPQTIVSFETPGSYAINDPRFNEPYY
PINNTLNDTLFKKYWKKASKLKNLHLLGRLATYQYIDMDKAILLSIKKAQ
QLLS

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATGTAATTCTATCCGTGATGTTGTTTTCTTCCCCCAGTTGCGTGAA
CATAAATAGTTTTGATATTTTAATTGTTGGTGCTGGTATTAGTGGAATAG
TACTAGCTAACATCTTAGCTAATCACAATAAAAGGGTTTTAATTGTTGAA
AAAAGAGATCATATTGGTGGTAACTGTTATGATAAAGTTGATAGTAAAAC
TCAACTCTTGTTTCACCAGTATGGACCCCATATTTTCCATACTAACAACC
AAACTGTTATTAACTTTATCTCACCCTTCTTTGAACTAAATAACTACCAC
CATCGGGTTGGTTTAAAATTGAAAAATAACCTAGATTTAACCTTACCCTT
TGATTTTCAACAGATCTATAAACTAATGGGAAAAGATGGTAGAAAACTCG
TTAGTTTTTTTAAAGAAAATTTCAGTTTAAATACTCATCTATCATTAGCA
GAATTACAACTAATTGATAATCCTTTAGCACAAAAACTCTATCAGTTTTT
AATTAGTAATGTTTATAAACCATACAGTGTCAAAATGTGGGGTTTACCAT
TTGCAATGATTAATGAGAATGTTATTAACAGGGTCAAGATAGTTTTAAGT
GAACAAAGCAGTTATTTTCCTGATGCAATTATCCAGGGATTACCTAAATC
AGGTTATACAAACAGTTTTCTTAAGATGTTAGCCAATCCCTTAATTGATG
TGCAGTTAAACTGCAAAGATAACCTTTTAGTTTATCAAGATGAAAAACTG
TTTTTTAACAATAACTTAATAGAAAAACCAGTTGTTTACTGTGGCTTAAT
TGACAAGCTATTTAACTTTTGCTTTGGTCATTTGCAATACCGTTCTCTTG
CCTTTAGTTGAAAAAGATTTAACCAAAAAAAATACCAAACCTACCCTGTT
GTTAATATGCCTTTAGCTAAATCAATCACAAGGAGTGTGGAATACAAACA
ACTAACAAACCAAGGTTCTTTCAAACCGCAAACCATCGTTAGTTTTGAAA
CCCCTGGCAGCTATGCAATTAACGATCCTAGGTTTAATGAACCTTATTAC
CCAATTAACAATACACTAAATGATACTCTTTTTAAAAAGTACTGAAAAAA
AGCAAGTAAGTTAAAGAATCTACACCTTTTGGGAAGATTAGCAACCTACC
AATACATTGATATGGATAAAGCAATCCTACTTAGTATTAAAAAAGCCCAA
CAACTGTTAAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy