Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR96 IGR92 IGR95 IGR97 IGR94 IGR93 MG133 MG135 MG131 MG134 MG130 lysS, - MG136 MG139 lepA, - MG138 MG133 MG135 MG131 MG134 MG130 lysS, - MG136 MG139 lepA, - MG138 Type: inverted, Name:  - 63 MG133 MG135 MG132 MG132 MG131 MG134 MG130 lysS, - MG136 MG139 lepA, - MG138 glf, - MG137 glf, - MG137
* Calculated from Protein Sequence

Gene ID: MG136

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lysS  

Definition:
lysyl-tRNA synthetase

Gene Start:
160962

Gene Stop:
162431

Gene Length:
1470

Molecular Weight*:
56555

pI*:
7.80

Net Charge*:
3.89

EC:
6.1.1.6  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00363.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to lysyl-tRNA synthetase sequences,
e.g. residues 1-490 are 72% similar to SYK_MYCPN.
MG136 is similar to T.pallidum TP1040(lysyl-tRNA synthetase) and
TP0985(aspartyl-tRNA synthetase). It is also similar to
C.trachomatis sequences CT781(lysyl-tRNA synthetase) and
CT542(aspartyl-tRNA synthetase).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0017 is ehgpcmy.
COG name: Lysyl/asparaginyl/aspartyl-tRNA synthetases.
Functional Class: J
BeTs to e-g-cmy.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 6-52, 53-86, 87-170, 173-404, 405-451, 405-483 constitute
defined domains of SYK_MYCGE.

Paralogs:  Local Blast Search
MG136 is paralogously related to MG036(aspartyl-tRNA synthetase)
and MG113(asparaginyl-tRNA synthetase): residues 49-485 are 23%
similar to MG036 and residues 29-386 are 22% similar to MG113.

Pfam Summary:  Pfam Search
Residues 59 to 132 (E-value = 4.4e-17) place MG136 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 148 to 488 (E-value = 1.7e-140) place MG136 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

PDB Hit:
gi|1311301|pdb|1LYL|A Chain A, Lysyl-Trna Synthetase (Lysu) (E.C.6.1.1.6) Complexed With Lysine Mol_id: 1; Molecule: Lysyl-Trna Synthetase (Lysu); Chain: A, B, C; Ec: 6.1.1.6; Mol_id: 2; Molecule: Lysine; Chain: X, Y, Z

Gene Protein Sequence:
MSDRLNDQAQHRLQKLLRLKQTNNDPYLVTKTSLTHSSKSFQVEFEKCSE
EELKKKATVSLAGRIIAIRQTFLIIQDFDGQVQLYINKKIHPKLFDYFNE
FVDIGDQIVVSGKPMLTKTKVLTLAVEEMKIIAKCLLVPPEKWHGLTDIE
TRARKRFLDLTYNLAMRDVFLKRTKIIKSIRSFLDQNGFIEVETPTLQAV
LGGANAKPFKTHYNALKADFYLRIANEIALKKLIIGGFNKVYEMGKMFRN
EGVDTTHNPEFTSIEIYQAYADFEVMLVLVEKLIQSLCESLNQFSFNWNN
KTINLKTPFHKITMVELIKKVTGIDFNSVKDDQSAILLAEKHHVKLAKHQ
QNKQHIINLFFEQFCEQTLIEPTFVTHYPKAVSPLAKQDPSNPEFTQRFE
LFINGKEIANAYSELNDPLEQRKRFEQQLEEKQLGNDETSELDESFLEAL
SFGMVNTAGLGIGIDRLVMLLCECNSIRDVVFFPQLREHK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGATCGTTTAAATGATCAAGCCCAACATCGCTTGCAGAAACTTTT
AAGGTTAAAACAAACTAATAATGACCCTTATTTAGTAACAAAAACTAGTC
TAACCCATTCTTCAAAAAGCTTTCAAGTTGAATTTGAAAAATGTTCAGAA
GAAGAGTTGAAGAAAAAAGCAACTGTCTCACTAGCTGGAAGGATCATTGC
TATTAGACAAACCTTTTTAATTATTCAAGATTTTGATGGTCAAGTCCAAC
TTTACATCAATAAAAAAATCCATCCTAAGTTATTTGATTACTTTAATGAA
TTTGTTGATATTGGTGATCAAATTGTTGTTAGTGGTAAGCCAATGTTAAC
TAAAACAAAGGTATTAACTTTAGCTGTTGAAGAGATGAAAATCATTGCTA
AGTGTTTATTGGTTCCACCTGAAAAGTGACATGGACTTACTGATATTGAA
ACCCGCGCTCGCAAGCGCTTTCTTGATCTTACCTATAACTTAGCAATGCG
TGATGTTTTTCTGAAACGCACTAAGATTATTAAATCAATCCGTAGCTTTC
TTGATCAAAATGGTTTTATTGAAGTTGAAACCCCCACTTTACAAGCTGTT
TTAGGAGGAGCTAATGCTAAACCCTTTAAAACCCATTACAATGCTTTAAA
AGCGGATTTTTATCTCAGAATTGCTAATGAAATAGCATTAAAAAAACTCA
TTATTGGTGGATTTAACAAGGTTTATGAAATGGGTAAAATGTTCCGTAAT
GAAGGGGTTGATACTACCCACAATCCTGAGTTTACCAGTATTGAAATATA
TCAAGCTTATGCAGATTTTGAAGTCATGCTTGTGCTTGTTGAAAAGCTGA
TTCAATCACTTTGTGAAAGCTTAAACCAATTTAGCTTTAACTGAAATAAC
AAAACGATTAATCTAAAAACACCATTTCATAAGATAACAATGGTTGAACT
TATTAAGAAAGTTACAGGGATCGATTTTAATTCAGTAAAAGATGATCAAT
CTGCCATTTTATTAGCAGAAAAACATCATGTTAAACTAGCAAAACACCAA
CAAAATAAGCAACACATCATTAATTTGTTTTTTGAACAGTTTTGTGAACA
AACATTAATTGAACCTACCTTTGTAACCCATTATCCAAAAGCAGTTTCTC
CTTTAGCAAAACAAGATCCTTCAAATCCTGAATTCACCCAACGATTTGAA
CTTTTTATTAATGGTAAAGAGATTGCTAATGCTTACAGTGAGCTAAACGA
TCCTTTAGAACAAAGAAAAAGGTTTGAACAACAACTTGAAGAAAAACAGC
TTGGTAATGATGAGACAAGTGAACTTGATGAATCGTTTTTAGAAGCATTA
AGTTTTGGGATGGTAAACACTGCTGGGCTTGGGATAGGTATTGATCGTTT
GGTAATGTTGTTATGTGAATGTAATTCTATCCGTGATGTTGTTTTCTTCC
CCCAGTTGCGTGAACATAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy