Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR91 IGR92 IGR88 IGR90 IGR89 IGR95 IGR87 IGR94 IGR93 MG133 MG135 trpS, - MG126 MG131 MG134 trx, - MG124 MG127 MG128 MG125 MG123 MG130 lysS, - MG136 MG133 MG135 trpS, - MG126 MG131 MG134 trx, - MG124 MG127 MG128 MG125 MG123 MG130 lysS, - MG136 MG133 MG135 trpS, - MG126 MG132 MG132 MG131 MG134 trx, - MG124 MG127 MG128 MG125 MG123 MG130 lysS, - MG136 ptsG, - MG129 ptsG, - MG129
* Calculated from Protein Sequence

Gene ID: MG129

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsG  

Definition:
probable PTS glucose-specific permease

Gene Start:
156222

Gene Stop:
156572

Gene Length:
351

Molecular Weight*:
13440

pI*:
10.61

Net Charge*:
8.93

EC:
2.7.1.69  

Functional Class:
Transport and binding; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Aminosugars metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism

Comment:
Probable glucose specific PTS C component.

Notice EC# and pathways are based on numerous subthreshold hits. The proximity of other predicted pts components is a factor.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed a significant hit to a
the MG129 homolog in Mycoplasma pneumoniae,(AE000056) and to a
PTS glucose-specific permease. Residues 1-117 are 61% similar to
the M. pneumoniae protein and residues 4-115 are 25% similar to
PTGA_BACST, PTS glucose-specific permease of Bacillus stearothermophilus,
(U12340).

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKWLLWLGYIFSFGLLYLWIVKKSKQIAQQPNTKLVESTSIPFKVKDFVS
ACGGKENFVNIKTTPTQLIVTFKDVNSVSLTKLNALNIKGINKNQNQFRF
VLGNFVNELKKKIEDEQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATGGTTGTTGTGATTGGGTTATATTTTTAGTTTTGGTTTACTCTA
TCTTTGGATAGTAAAAAAATCAAAACAAATTGCTCAACAACCTAACACAA
AACTGGTTGAATCAACTTCTATTCCTTTTAAAGTTAAGGACTTTGTTAGT
GCTTGTGGTGGTAAGGAAAATTTTGTTAATATAAAAACAACACCAACTCA
ATTAATAGTTACTTTTAAAGATGTTAACTCAGTGAGCTTAACAAAGCTTA
ATGCGCTTAATATCAAAGGAATTAACAAAAACCAAAACCAATTTCGTTTT
GTACTTGGTAACTTTGTAAATGAATTGAAAAAAAAGATAGAAGATGAACA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy