Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR85 IGR88 IGR84 IGR89 IGR86 IGR87 trpS, - MG126 trx, - MG124 MG127 MG125 rbsC-2, - MG121 rbsC-1, - MG120 mglA, - MG119 topA, - MG122 trpS, - MG126 trx, - MG124 MG127 MG125 rbsC-2, - MG121 rbsC-1, - MG120 mglA, - MG119 topA, - MG122 trpS, - MG126 trx, - MG124 MG127 MG125 rbsC-2, - MG121 rbsC-1, - MG120 mglA, - MG119 topA, - MG122 MG123 MG123
* Calculated from Protein Sequence

Gene ID: MG122

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
topA  

Definition:
DNA topoisomerase I

Gene Start:
149198

Gene Stop:
151324

Gene Length:
2127

Molecular Weight*:
82537

pI*:
9.98

Net Charge*:
27.73

EC:
5.99.1.2  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous enzymes

Comment:
The reaction catalyzed by topoisomerases leads to the conversion of one topological isomer of DNA to another. When a topoisomerase transiently breaks a DNA backbone bond, it simultaneously forms a protein-DNA link, in which a tyrosyl oxygen in the enzyme is joined to a DNA phosphorus at one end of the enzyme-severed DNA strand.

See Prosite PDOC00333.

From Prosite: DNA topoisomerase I (EC 5.99.1.2) is one of the two types of enzyme that catalyze the interconversion of topological DNA isomers. Type I topoisomerases act by catalyzing the transient breakage of DNA, one strand at a time, and the subsequent rejoining of the strands. When a prokaryotic type I topoisomerase breaks a DNA backbone bond, it simultaneously forms a protein-DNA link where the hydroxyl group of a tyrosine residue is joined to a 5'-phosphate on DNA, at one end of the enzyme-severed DNA strand.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to DNA Topoisomerase I.
For example residues 1 -705 are 71% similar to TOP1_MYCPN, DNA
topoisomerase I of Mycoplasma pneumoniae,(AE000056). In addition,
residues 5-708 are 36% similar to DNA Topoisomerase I of Bacillus
subtilis,(AJ000975). Residues 3-699 are 31% similar to TP0394, DNA topoisomerase I of
T. pallidum. Residues 1-706 are 35% similar to CT643, DNA
topoisomerase I of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0550 is ehgpcmy.
COG name: Topoisomerase type I.
Functional Class: L
BeTs to -hg-cmy.

Blocks Summary:  Blocks Search
Residues 97-107, 149-166, 175-206, 293-320, 330-339, and 495-532 represent
significant (100%) hits to blocks BL00396A,B,C,D,E,F, Prokaryotic DNA
topoisomerase I proteins. Residues 473-491 represent a significant
(96%) hit to block BL00494D, Bacterial luciferase subunits proteins.

ProDom Summary:  Protein Domain Search
Residues 6-26, 40-64, 77-168, 175-362, 363-407, 408-493, 499-535, and
536-590 constitute defined domains of TOP1_MYCGE. Residues 614-678
are 76% similar to DNA topoisomerase I as represented by TOP1_MYCPN.
Residues 463-564 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 3 to 125 (E-value = 1e-34) place MG122 in the Toprim family which is described as Toprim domain (PF01751)
Residues 139 to 575 (E-value = 3.2e-201) place MG122 in the Topoisom_bac family which is described as DNA topoisomerase (PF01131)
Residues 615 to 655 (E-value = 9.1e-17) place MG122 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)
Residues 664 to 705 (E-value = 7e-18) place MG122 in the zf-C4_Topoisom family which is described as Topoisomerase DNA binding C4 zinc finger (PF01396)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
541  
617

PDB Hit:
gi|1127274|pdb|1ECL| Molecule: Escherichia Coli Topoisomerase I; Domain: Amino-Terminal 67kda; Synonym: Escherichia Coli Omega Protein; Mutation: Gly Ser Insertion At N-Terminus, Insertion Of Stop Codon At 598; Engineered; Ec: 5.99.1.2

Gene Protein Sequence:
MIKNLVVIESPNKVKTLKQYLPSDEFEIVSTVGHIREMVYKNFGFDENTY
TPIWEDWTKNKQKNPKQKHLLSKFEIIKSIKAKASDAQNIFLASDPDREG
EAISWHVYDLLDQKDKAKCKRITFNEITKKAVVDALKQPRNIDLNWVESQ
FARQILDRMIGFRLSRLLNSYLQAKSAGRVQSVALRFLEEREKEIAKFVP
RFWWTVDVLLNKENNQKVVCANKSIPLVLREINPELSASLKLDFEAAENV
SGIDFLNEASATRFANQLTGEYEVYFIDEPKIYYSSPNPVYTTASLQKDA
INKLGWSSKKVTMVAQRLYEGISVNGKQTALISYPRTDSIRISNQFQSEC
EKYIEKEFGSHYLADKNKLKRHKKDEKIIQDAHEGIHPTYITITPNDLKN
GVKRDEFLLYRLIWIRTVASLMADAKTSRTIVRFINQKNKFYTSSKSLLF
DGYQRLYEEIKPNTKDELYIDLSKLKIGDKFSFEKISVNEHKTNPPPRYT
QASLIEELEKSNIGRPSTYNTMASVNLERGYANLVNRFFYITELGEKVNN
ELSKHFGNVINKEFTKKMEKSLDEIAENKVNYQEFLKQFWTNFKSDVKLA
ENSIQKVKKEKELVERDCPKCNQPLVYRYTKRGNEKFVGCSDFPKCKYSE
FSNPKPKLTLETLDELCPECNNKLVKRRTKFNAKKTFIGCSNFPNCRFIK
KDNAAEFKQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAAAACCTGGTGGTGATTGAATCACCCAATAAAGTTAAAACATT
AAAACAATATCTTCCTAGTGATGAATTTGAGATAGTCTCAACCGTTGGTC
ACATCAGAGAAATGGTGTATAAAAACTTTGGTTTTGATGAAAATACCTAT
ACCCCTATCTGAGAAGATTGAACTAAAAATAAACAGAAAAATCCCAAACA
GAAACACCTGCTCAGTAAGTTTGAGATCATCAAATCAATCAAAGCTAAAG
CTAGTGATGCACAAAACATTTTTTTAGCTTCTGACCCTGATAGAGAAGGG
GAAGCCATCTCTTGGCATGTCTATGATTTATTGGATCAAAAAGATAAAGC
TAAGTGCAAACGAATCACTTTCAATGAGATCACTAAAAAAGCAGTAGTAG
ATGCATTAAAACAACCGCGTAACATCGATCTTAACTGGGTTGAAAGTCAG
TTTGCCCGCCAAATCCTTGACAGGATGATAGGTTTTAGATTATCAAGATT
ATTAAATAGTTATCTGCAAGCAAAGTCTGCAGGTAGAGTTCAATCAGTGG
CTTTGCGCTTTCTTGAGGAAAGAGAAAAGGAGATAGCTAAGTTTGTTCCG
CGTTTTTGGTGGACAGTTGATGTTTTATTAAACAAAGAAAATAACCAAAA
AGTAGTTTGTGCAAACAAGTCTATTCCTTTGGTTTTAAGAGAAATTAACC
CTGAATTAAGTGCTAGTTTAAAACTGGATTTTGAAGCTGCTGAAAACGTA
TCAGGAATTGACTTTTTAAATGAAGCTTCAGCAACCAGATTTGCCAACCA
ACTGACTGGCGAATATGAAGTTTATTTTATTGATGAACCTAAGATTTACT
ATTCATCTCCAAACCCAGTTTATACCACCGCTTCACTTCAAAAGGATGCA
ATTAATAAGTTAGGATGGTCTTCCAAAAAAGTAACAATGGTGGCCCAAAG
ACTGTATGAAGGGATTAGTGTTAATGGGAAACAAACTGCATTAATTAGTT
ATCCAAGAACTGATTCAATTAGGATTTCAAACCAATTTCAATCAGAGTGT
GAAAAGTACATTGAAAAGGAGTTTGGAAGTCATTATTTAGCTGATAAAAA
TAAGTTAAAAAGACATAAAAAGGATGAGAAAATCATCCAAGATGCCCATG
AAGGGATCCATCCTACTTACATTACTATTACCCCCAATGATCTGAAAAAC
GGGGTGAAACGCGATGAGTTTCTCCTTTATCGTTTAATATGGATTAGAAC
AGTTGCTAGTTTAATGGCAGATGCTAAAACATCAAGAACTATTGTTCGTT
TTATAAACCAAAAAAACAAGTTTTATACCTCTTCAAAATCACTTTTATTT
GATGGTTATCAAAGGTTATATGAAGAGATTAAACCTAATACTAAAGATGA
ACTTTACATTGATCTTAGTAAGCTTAAAATTGGTGATAAATTTAGTTTTG
AAAAGATCAGCGTTAATGAGCATAAAACCAACCCACCACCACGTTACACC
CAAGCTAGTTTAATTGAAGAGCTTGAAAAATCTAACATCGGTCGTCCCTC
TACTTATAACACTATGGCCAGTGTTAATCTAGAAAGGGGCTATGCTAACT
TAGTGAACCGATTTTTTTATATCACTGAGCTTGGTGAAAAAGTTAATAAT
GAACTTTCCAAGCATTTTGGGAATGTAATTAATAAAGAATTTACCAAGAA
GATGGAAAAATCTTTGGATGAAATTGCTGAAAACAAAGTAAACTATCAAG
AATTTCTTAAGCAGTTTTGAACAAATTTTAAATCTGATGTTAAACTAGCT
GAAAATTCAATTCAAAAAGTGAAAAAGGAAAAAGAATTGGTTGAAAGAGA
TTGTCCTAAATGTAATCAACCGTTGGTATATCGTTACACCAAAAGAGGTA
ATGAGAAGTTTGTTGGTTGTAGTGATTTTCCTAAGTGTAAATACAGTGAG
TTTAGTAATCCTAAACCAAAACTAACCTTGGAAACACTTGATGAATTGTG
TCCTGAGTGTAACAATAAACTGGTTAAGAGGAGAACTAAATTTAACGCTA
AAAAGACCTTTATAGGTTGCAGTAATTTCCCTAACTGCCGTTTTATCAAA
AAGGATAATGCTGCTGAATTTAAACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy