Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR85 IGR84 IGR82 IGR80 IGR83 IGR86 IGR81 MG115 cfxEc, - MG112 MG116 rbsC-2, - MG121 galE, - MG118 asnS, - MG113 rbsC-1, - MG120 mglA, - MG119 topA, - MG122 MG115 cfxEc, - MG112 MG116 rbsC-2, - MG121 galE, - MG118 asnS, - MG113 rbsC-1, - MG120 mglA, - MG119 topA, - MG122 Type: inverted, Name:  - 63 MG115 cfxEc, - MG112 MG116 rbsC-2, - MG121 galE, - MG118 asnS, - MG113 rbsC-1, - MG120 mglA, - MG119 topA, - MG122 MG117 pgsA, - MG114 MG117 pgsA, - MG114
* Calculated from Protein Sequence

Gene ID: MG118

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
galE  

Definition:
UDP-glucose 4-epimerase

Gene Start:
143935

Gene Stop:
144954

Gene Length:
1020

Molecular Weight*:
38412

pI*:
9.16

Net Charge*:
7.45

EC:
5.1.3.2  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Carbohydrate Metabolism; Galactose metabolism
Nucleotide Metabolism; Nucleotide sugars metabolism

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to UDP-glucose
4-epimerase proteins. For example residues 1-337 are 54% similar to
GALE_MYCPN, UDP-glucose 4-epimerase galE of Mycoplasma pneumoniae,
(AE000056). Residues 7-340 are 33% similar to residues 2-323 of
GALE_CORDI, UDP-glucose 4-epimerase of Corynebacterium diphtheriae,
(M80338).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0451 is ehgpcmy.
COG name: Nucleoside-diphosphate-sugar epimerases.
Functional Class: M,G
BeTs to e-g-cmy.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 9-113, 134-153, 160-189, 198-234, 235-319, and 320-340 constitute
defined domains of GALE_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 8 to 336 (E-value = 1.4e-52) place MG118 in the Epimerase family which is described as NAD dependent epimerase/dehydratase family (PF01370)

PDB Hit:
gi|1942240|pdb|1XEL| Udp-Galactose 4-Epimerase From Escherichia Coli Isomerase Mol_id: 1; Molecule: Udp-Galactose 4-Epimerase; Chain: Null; Ec: 5.1.3.2; Other_details: NadhUDP-Glucose Abortive Complex

Gene Protein Sequence:
MIGAKTRVAIVGGIGYIGSCFASFIKEQNDKLIVTVIDNNKNNHVIKLLK
KIGIEFYFADLLDRHKLTEVIAAIQPDVVFHFAAKTSVSESVHNPLKYFD
CNVIGTLNLISAISNLQKPIKLFFASSAAVYGQTTNSYISEEIVITETQA
TNPYGLSKFLDELILNAVAKNSQLQVVCLRFFNVAGAILPFGNFNGNTTL
LIPNLVKAFLKQTPFFLYGNDYATKDGSCIRDYIHVYDICNAHFLLWKWL
NDHRQIKFETFNLGSGIGTSNLEVIDIAKKVFYPSRLNLEIRPKRSWDPA
ILVANVAKAKQTFQFKITRNLKDMISDERNFYENFYNDAY

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGGAGCAAAGACTAGGGTTGCAATAGTTGGCGGGATTGGTTACAT
AGGTAGTTGTTTTGCTAGTTTTATCAAAGAACAAAATGATAAGCTAATTG
TTACTGTTATTGATAACAACAAAAATAACCATGTAATTAAACTCTTAAAA
AAGATTGGAATTGAATTCTATTTTGCTGATTTACTAGATAGACATAAGCT
AACTGAAGTAATTGCAGCAATTCAACCTGATGTGGTATTTCACTTTGCTG
CTAAAACAAGTGTAAGTGAATCAGTACATAATCCATTGAAGTACTTTGAT
TGCAATGTAATTGGTACTTTAAACCTAATTAGTGCAATTAGTAACTTACA
GAAGCCAATTAAATTATTTTTCGCTTCTAGTGCTGCAGTGTATGGTCAAA
CAACTAATAGTTACATTAGTGAAGAGATTGTAATAACTGAAACACAAGCA
ACCAATCCTTATGGATTGAGTAAGTTTTTAGATGAATTAATCTTAAATGC
AGTTGCCAAAAATAGTCAACTACAAGTTGTTTGCTTACGCTTTTTTAATG
TGGCAGGTGCAATTCTGCCATTTGGTAATTTTAATGGTAATACCACGCTT
TTAATTCCTAACTTAGTAAAAGCCTTTTTAAAACAAACTCCCTTTTTTTT
ATATGGCAATGATTATGCAACTAAGGATGGTAGTTGCATAAGAGATTACA
TCCATGTTTATGATATATGTAATGCTCATTTCTTATTATGAAAGTGGTTA
AATGATCATCGCCAAATTAAATTTGAAACCTTTAACTTGGGGAGTGGGAT
AGGAACTTCTAATTTAGAAGTTATTGATATTGCTAAAAAAGTGTTTTATC
CTAGTAGATTAAATTTAGAAATTAGACCAAAAAGAAGCTGAGATCCAGCA
ATTTTAGTAGCAAATGTTGCTAAAGCAAAACAAACCTTTCAATTCAAAAT
AACGCGTAATTTGAAAGATATGATAAGTGATGAGCGTAATTTTTATGAGA
ATTTTTATAATGACGCTTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy