Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR82 IGR80 IGR83 IGR79 IGR77 IGR78 IGR81 MG115 MG110 MG116 ptc1, - MG108 galE, - MG118 pkn, - MG109 pgiB, - MG111 asnS, - MG113 mglA, - MG119 MG115 MG110 MG116 ptc1, - MG108 galE, - MG118 pkn, - MG109 pgiB, - MG111 asnS, - MG113 mglA, - MG119 Type: inverted, Name:  - 63 MG115 MG110 MG116 ptc1, - MG108 galE, - MG118 pkn, - MG109 pgiB, - MG111 asnS, - MG113 mglA, - MG119 cfxEc, - MG112 MG117 pgsA, - MG114 cfxEc, - MG112 MG117 pgsA, - MG114
* Calculated from Protein Sequence

Gene ID: MG113

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
asnS  

Definition:
asparaginyl-tRNA synthetase

Gene Start:
140039

Gene Stop:
141406

Gene Length:
1368

Molecular Weight*:
52075

pI*:
9.85

Net Charge*:
12.47

EC:
6.1.1.22  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Alanine and Aspartate metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00363.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to asparaginyl-tRNA synthetase sequences,
e.g. residues 1-456 are 67% similar to SYN_MYCPN.
MG113 is similar to T.pallidum TP0609(asparaginyl-tRNA synthetase)
and TP0985(aspartyl-tRNA synthetase). It is also similar to
C.trachomatis CT542(aspartyl-tRNA synthetase) and CT781(lysyl-tRNA
synthetase) sequences.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0017 is ehgpcmy.
COG name: Lysyl/asparaginyl/aspartyl-tRNA synthetases.
Functional Class: J
BeTs to -hg-cmy.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 20-54, 55-77, 78-103, 140-375, 376-447 constitute
defined domains of SYN_MYCGE.
Residues 15-104 are 31% similar to a aspartyl-tRNA domain from
SYD_PYRSK.

Paralogs:  Local Blast Search
MG113 is paralogously related to MG136(lysyl-tRNA synthetase) and
MG036(aspartyl-tRNA synthetase): residues 4-450 are 22% similar to
MG136 and residues 18-449 are 22% similar to MG036.

Pfam Summary:  Pfam Search
Residues 21 to 101 (E-value = 2.9e-16) place MG113 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 116 to 452 (E-value = 1.4e-94) place MG113 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
239  
278

PDB Hit:
gi|1064982|pdb|1ASY|A Chain A, Aspartyl Trna Synthetase (Asprs) (E.C.6.1.1.12) Complexed With Transfer Ribonucleic Acid (Trnaasp)

Gene Protein Sequence:
MKSVTVKQLLQTPRKFNNKQIKLSGWVKNKRASANIIFLAISDGSSINTL
QAVVKQEDNPQVFSLLQTVNLASAVMVWGEIILTPKAKQPLELKLKQVSL
LAQAESDYPLQKKEHSQEFFRSNAHLRVRAKTYFAVMKIRSVLSHAIFEY
FFKNDFILVQSPILTSNDCEGAGETFVIKDSETFFNKTTFLTVSGQFGAE
AFAQAFKKVFTFGPTFRAEKSHTNRHLSEFWMIEPEIAFANLKDLMQLIQ
NLIKFLIKKVMENASDELNVLAKQFSNDIISNLKTIISTKKFPIIEYSKA
LAILKESSDTKKTNFELNDFSFGIDLKTEHERFLCEQYFQNQPLFVINYP
KELKAFYMKTNTDNKTVAAVDLLLPKIGEICGGSERESDLNQLKNRCQSL
NIDTKSLNWYLDMRKWGYFASAGFGLGFDRLLAYICGLENIRDAIPFPRV
HGTINF

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATCAGTTACAGTCAAGCAGTTACTACAAACCCCACGAAAATTTAA
TAACAAGCAGATTAAACTATCAGGTTGGGTTAAAAATAAACGTGCTAGTG
CTAACATCATCTTTCTAGCAATTAGTGATGGCTCTAGTATTAATACCCTA
CAAGCAGTAGTAAAACAAGAAGATAACCCCCAGGTTTTCTCACTGTTACA
AACTGTTAATTTAGCAAGTGCTGTTATGGTTTGAGGGGAAATTATCTTAA
CCCCAAAAGCTAAACAACCACTGGAGTTGAAATTAAAGCAGGTGAGTTTA
TTAGCACAAGCAGAGTCTGATTATCCACTGCAAAAAAAAGAACATAGTCA
AGAGTTTTTTAGAAGTAATGCGCATCTAAGAGTAAGAGCAAAAACTTACT
TTGCAGTGATGAAAATAAGGAGTGTTTTGTCACACGCAATCTTTGAATAC
TTCTTTAAAAATGATTTTATCTTAGTGCAAAGCCCTATTTTAACTAGTAA
TGATTGTGAGGGAGCGGGGGAAACATTTGTAATTAAAGATAGTGAAACTT
TTTTTAATAAAACGACTTTTTTAACAGTAAGTGGCCAGTTTGGAGCAGAA
GCTTTTGCGCAAGCATTTAAAAAGGTTTTCACCTTTGGTCCTACTTTCAG
AGCTGAAAAATCCCATACTAATCGTCATCTTAGTGAGTTTTGGATGATCG
AACCTGAAATTGCATTTGCTAACTTAAAAGATTTAATGCAGTTAATACAA
AACCTAATTAAATTCTTAATTAAAAAAGTGATGGAAAATGCTAGTGATGA
ACTAAATGTTTTAGCAAAGCAATTTAGCAATGACATTATTAGCAACTTAA
AGACAATCATTAGTACTAAAAAATTTCCAATCATTGAATACAGCAAAGCA
TTAGCGATTCTAAAGGAATCTAGTGATACAAAAAAAACTAATTTTGAACT
AAACGACTTTAGTTTTGGTATTGACTTAAAAACAGAACATGAACGCTTTT
TGTGCGAACAATATTTTCAAAATCAACCGCTTTTTGTTATTAACTATCCA
AAGGAGTTAAAGGCATTTTACATGAAAACAAATACTGACAATAAAACTGT
TGCTGCAGTTGATCTTTTATTACCAAAGATTGGTGAGATTTGTGGGGGAA
GTGAAAGGGAAAGTGATTTAAACCAACTTAAGAATAGGTGTCAATCTTTA
AACATTGACACAAAAAGTTTGAACTGATATCTTGATATGAGGAAATGGGG
TTATTTTGCTAGTGCAGGTTTTGGTTTGGGCTTTGATAGATTATTAGCTT
ATATATGTGGATTGGAAAACATCAGAGATGCTATTCCCTTTCCCCGTGTA
CATGGCACCATTAACTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy