Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR76 IGR82 IGR80 IGR79 IGR77 IGR78 IGR81 pdf,def, - MG106 MG115 MG105 MG110 MG116 gmk, - MG107 ptc1, - MG108 pkn, - MG109 pgiB, - MG111 asnS, - MG113 pdf,def, - MG106 MG115 MG105 MG110 MG116 gmk, - MG107 ptc1, - MG108 pkn, - MG109 pgiB, - MG111 asnS, - MG113 Type: inverted, Name:  - 63 pdf,def, - MG106 MG115 MG105 MG110 MG116 gmk, - MG107 ptc1, - MG108 pkn, - MG109 pgiB, - MG111 asnS, - MG113 cfxEc, - MG112 MG117 pgsA, - MG114 cfxEc, - MG112 MG117 pgsA, - MG114
* Calculated from Protein Sequence

Gene ID: MG111

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgiB  

Definition:
phosphoglucose isomerase B

Gene Start:
138105

Gene Stop:
139403

Gene Length:
1299

Molecular Weight*:
49488

pI*:
10.05

Net Charge*:
14.81

EC:
5.3.1.9  

Functional Class:
Energy metabolism; Glycolysis and Gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Pentose phosphate cycle
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:
This enzyme interconverts glucose-6-phosphate and fructose-6-phosphate
during glycolysis and gluconeogenesis. In E.coli it is a homodimer.

See Prosite PDOC00157.

From Prosite:

Phosphoglucose isomerase (EC 5.3.1.9) (PGI) is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. PGI is involved in different pathways: in most higher organisms it is involved in glycolysis; in mammals it is involved in gluconeogenesis; in plants in carbohydrate biosynthesis; in some bacteria it provides a gateway for fructose into the Entner-Doudouroff pathway. PGI has been shown to be identical to neuroleukin, a neurotrophic factor which supports the survival of various types of neurons.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits phosphoglucose isomerases.
For example residues 2-429 are 67% similar to G6PI_MYCPN, phosphoglucose
isomerase B of Mycoplasma pneumoniae, (AE000057).
In addition, residues 44-429 are 34% similar to residues 41-433 of
glucose-6-phosphate isomerase of Bacillus subtilis,(Z99120).
Residues 79-291 are 26% similar to residues 150-364 of TP0475,
glucose-6-phosphate isomerase of T. pallidum. Residues 77-291 are 27%
similar to residues 140-352 of CT378, glucose-6-phosphate isomerase of
C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0166 is ehgpcmy.
COG name: Glucose-6-phosphate isomerase.
Functional Class: G
BeTs to -hg-cmy.

Blocks Summary:  Blocks Search
Residues 61-94, 115-157, 185-211, 250-292, and 390-422 represent significant
(99%) hits to blocks BL00765B,C,D,E,H, Phosphoglucose isomerase proteins.
Residues 108-119 represent a significant (95%) hit to block BL00177C,
DNA topoisomerase II proteins.

ProDom Summary:  Protein Domain Search
Residues 1-56, 57-76, and 77-423 represent defined domains of G6PI_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 11 to 432 (E-value = 4.7e-29) place MG111 in the PGI family which is described as Phosphoglucose isomerase (PF00342)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
317  
368
transmembrane  
387  
407

PDB Hit:


Gene Protein Sequence:
VFMSDKLLTIDLSHVYGFDKEIIFKKYQKKVDQIHQDFLAHKLADGHMTG
WYDQPDQNHQFLLKTINQIDKKFKSLKVTDIVYVGIGGSFTGIKTVLDFL
KPKQRTGLKIHFVPDLSAFQAASVIKEIKNKSWALITTSKSGRTLEPALN
FRIFRNLLNKRYGNKHYQRVVVITDEKKGLLTKMASNHGYQKLVIDSNIG
GRFSTLSPAGLLLAKLFGHDPKAILKGTLQAKKDLQTTSLENNSAYLYAV
VRHWLYTTKKFKIEVCIAYHSLYEYLLLQHRQLFGESEGKNDKSLFPTFS
IFTVDLHSMGQLYQEGEKVFFETVIDVKNPLVNINLPPSDFDNDDELDFL
LDKSLNEISDVAIDSVIKAHYQANVSIIKLTLKEQSAFMFGYFYFWLSVA
TVMSGSLLGHNVFNQPGVEVYKKLMFEKLRSGH

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTTATGAGTGATAAATTATTAACAATTGACTTAAGTCATGTTTATGG
ATTTGATAAAGAAATTATTTTTAAGAAATACCAAAAAAAAGTAGATCAAA
TTCACCAAGATTTTCTAGCTCATAAACTTGCTGATGGTCACATGACTGGG
TGGTATGACCAACCTGATCAAAACCACCAATTCCTTTTAAAAACCATTAA
TCAAATTGACAAAAAGTTTAAAAGTTTAAAAGTAACTGACATTGTTTATG
TTGGTATTGGTGGTTCTTTTACTGGTATTAAAACAGTTTTAGATTTCTTA
AAACCAAAACAAAGAACAGGATTAAAAATCCACTTTGTCCCTGACCTTTC
TGCTTTTCAAGCTGCAAGTGTTATTAAGGAAATTAAAAATAAATCATGGG
CTCTAATTACCACTTCTAAGTCTGGTAGAACCCTAGAACCAGCACTGAAT
TTCCGCATTTTTAGAAACTTATTAAACAAGCGTTATGGCAACAAACACTA
CCAAAGAGTAGTTGTTATTACTGATGAAAAAAAGGGATTACTAACCAAAA
TGGCATCAAATCATGGTTACCAAAAGTTAGTTATTGATTCAAATATCGGT
GGGCGTTTTTCAACTCTATCTCCTGCTGGTTTGTTACTAGCCAAACTTTT
TGGTCATGATCCTAAGGCCATCTTAAAAGGAACATTACAAGCCAAAAAGG
ATTTGCAAACAACTTCACTTGAAAACAATTCTGCATACCTTTATGCAGTA
GTTAGACATTGACTATACACCACAAAAAAATTCAAAATTGAAGTTTGCAT
TGCTTATCACAGTTTGTATGAATATTTGTTATTACAGCATCGACAACTTT
TTGGTGAATCAGAAGGTAAGAACGATAAATCTTTATTTCCTACTTTTTCG
ATTTTTACTGTTGACTTACACTCAATGGGACAACTCTATCAAGAAGGGGA
AAAAGTGTTTTTTGAAACAGTAATTGATGTTAAAAATCCACTTGTTAATA
TTAATTTACCTCCATCTGATTTTGACAATGATGATGAACTTGATTTCTTG
TTAGATAAAAGCTTAAATGAGATTTCAGATGTTGCAATTGATTCAGTTAT
TAAAGCGCACTACCAAGCAAATGTAAGCATTATTAAATTAACTTTAAAAG
AACAATCTGCATTTATGTTTGGTTATTTTTACTTTTGACTCTCTGTTGCT
ACAGTGATGAGTGGATCATTATTAGGGCATAATGTCTTTAATCAACCTGG
CGTTGAAGTTTATAAAAAGTTAATGTTTGAAAAACTAAGAAGTGGCCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy