Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR76 IGR75 IGR80 IGR79 IGR77 IGR78 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 pkn, - MG109 pgiB, - MG111 asnS, - MG113 vacB, - MG104 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 pkn, - MG109 pgiB, - MG111 asnS, - MG113 vacB, - MG104 Type: inverted, Name:  - 63 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 pkn, - MG109 pgiB, - MG111 asnS, - MG113 vacB, - MG104 cfxEc, - MG112 pgsA, - MG114 cfxEc, - MG112 pgsA, - MG114
* Calculated from Protein Sequence

Gene ID: MG109

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pkn  

Definition:
protein serine,threonine kinase

Gene Start:
136179

Gene Stop:
137264

Gene Length:
1086

Molecular Weight*:
41786

pI*:
10.15

Net Charge*:
11.41

EC:
2.7.1.-  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Nicotinate and nicotinamide metabolism
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism
Metabolism of Complex Lipids; Sphingoglycolipid metabolism

Comment:
See Prosite: PDOC00100, PDOC00212, PDOC00213, PDOC00629

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to protein kinases.
For example residues 1-341 are 71% similar to PKNS_MYCPN, probable
protein serine/threonine kinase of Mycoplasma pneumoniae,(AE000057).
In addition residues 1-278 are 29% similar to probable serine/threonine-specific protein kinase
of Arabidopsis thaliana,(U95973).
There were also significant hits to three protein kinases of
C. trachomatis. For example residues 27-295 are 23% similar to residues
30-292 of CT301, possible serine/threonine kinase.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0515 is --gpcmy.
COG name: Serine/threonine protein kinases.
Functional Class: R
BeTs to --g-c--.

Blocks Summary:  Blocks Search
Residues 129-159, 18-48, and 211-226 represent significant (98%) hits
to blocks BL00107A,B, Protein kinases ATP-binding region proteins.
Residues 338-361, 326-350, and 337-361 represent significant (96%) hits
to blocks PR00758C,H, ARSENICAL PUMP MEMBRANE PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 1-55 and 222-362 constitute defined domaind of PKNS_MYCGE.
Residues 57-204 are 33% similar to protein serine/threonine kinases,
as represented by PKD1_DICDI. Residues 96-188, 127-164, 209-231, and
209-227 also support matches to protein serine/threonine kinases.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 13 to 295 (E-value = 2.2e-19) place MG109 in the Pkinase family which is described as Protein kinase domain (PF00069)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
331  
361

PDB Hit:
gi|493956|pdb|1CTP|E Chain E, Camp-Dependent Protein Kinase (E.C.2.7.1.37) (Capk) (Catalytic Subunit)

Gene Protein Sequence:
MDSYLFLAKNLNLKNYGPVQKKQYGHLVLKVVQKNPKINENNWKKFLDEM
VTTTRVHHSNLVKSFDVVNPFLKIVRGNKTIALNQIVMIAMEYVDGPSLR
QLLNRKGYFSVSEVVYYFTKIVKAIDYLHSFKHQIIHRDLKPENILFTSD
LTDIKLLDFGIASTVVKVAEKTEVLTDENSLFGTVSYMIPDVLESTVNKA
GKKVRKPPNAQYDIYSLGIILFEMLVGRVPFNKSINPNKERETIQKARNF
DLPLMQATRSDIPNSLENIAFRCTAVKRENNKWLYSSTKELLEDLANWEN
EQAMIKPANERVLEGQVEIREMMLEKPLAWYFKTWALSIFTIVFIGLIIA
AIVLLLIFNARF

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTCCTATCTTTTTTTAGCAAAAAATTTGAACTTAAAAAACTATGG
ACCAGTTCAAAAAAAACAGTATGGACACTTAGTTTTAAAGGTGGTTCAAA
AAAATCCTAAGATTAATGAAAATAATTGGAAAAAGTTCCTTGATGAAATG
GTAACCACAACTAGAGTGCACCATTCTAACCTAGTGAAAAGTTTTGATGT
GGTGAACCCTTTTTTGAAAATAGTTCGTGGTAATAAAACAATTGCTCTCA
ATCAGATAGTGATGATTGCAATGGAGTATGTTGATGGCCCTTCTTTAAGA
CAATTGCTTAACAGAAAAGGCTACTTTAGTGTTAGCGAAGTAGTTTATTA
CTTTACAAAGATAGTAAAAGCCATTGATTATCTCCACAGTTTCAAGCACC
AAATTATCCACCGTGATCTTAAACCTGAAAACATCTTATTTACTAGTGAT
TTAACTGATATTAAACTATTAGATTTTGGCATTGCTTCAACAGTAGTTAA
AGTTGCTGAAAAAACCGAAGTTTTAACTGATGAAAATTCACTGTTTGGCA
CAGTTAGTTATATGATTCCTGATGTTTTGGAAAGCACAGTTAATAAAGCT
GGTAAAAAGGTTAGAAAACCACCCAATGCCCAGTATGATATCTACTCGTT
AGGAATTATTCTATTTGAGATGTTAGTTGGTAGAGTTCCATTTAACAAGT
CAATTAACCCCAACAAGGAAAGAGAAACAATCCAAAAAGCACGCAATTTT
GACTTACCTTTAATGCAAGCAACTAGAAGTGATATCCCAAATAGCTTAGA
AAATATTGCTTTTCGTTGTACTGCTGTGAAAAGAGAAAACAATAAGTGAC
TTTACAGTTCCACAAAAGAACTTTTAGAAGATTTGGCGAATTGAGAAAAT
GAACAAGCGATGATTAAACCTGCTAATGAAAGGGTTTTAGAAGGGCAGGT
GGAAATTAGAGAAATGATGCTTGAAAAGCCCTTAGCTTGGTATTTCAAAA
CTTGAGCCTTATCAATCTTTACTATCGTTTTTATAGGGTTAATTATTGCT
GCAATAGTTCTTTTATTAATTTTTAATGCCAGATTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy