Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR76 IGR75 IGR80 IGR79 IGR77 IGR78 IGR74 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 MG103 pkn, - MG109 pgiB, - MG111 asnS, - MG113 vacB, - MG104 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 MG103 pkn, - MG109 pgiB, - MG111 asnS, - MG113 vacB, - MG104 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 MG103 pkn, - MG109 pgiB, - MG111 asnS, - MG113 vacB, - MG104 cfxEc, - MG112 cfxEc, - MG112
* Calculated from Protein Sequence

Gene ID: MG108

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptc1  

Definition:
protein phosphatase 2C homolog

Gene Start:
135337

Gene Stop:
136116

Gene Length:
780

Molecular Weight*:
29946

pI*:
7.91

Net Charge*:
1.34

EC:
3.1.3.-  3.1.3.16  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Aminosugars metabolism
Nicotinate and nicotinamide metabolism
Riboflavin metabolism
Thiamine metabolism
Vitamin B6 metabolism

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed significant hits to hypothetical proteins and to
protein phosphatases. For example residues 1-257 are 51% similar to
PPH_MYCPN, protein phoshatase 2C homolog of Mycoplasma pneumoniae,
(AE000057). In addition residues 16-254 are 29% similar to a putative
Ptc1 protein of Bacillus subtilis,(Y13937).
Residues 6-255 are 27% similar to residues 5-248 of
CT259, protein phosphatase 2C homolog of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0631 is --gpc-y.
COG name: Protein serine/threonine phosphatases.
Functional Class: R
BeTs to --g-c-y.

Blocks Summary:  Blocks Search
Residues 36-56, 123-158, 198-210, 33-45, and 243-252 represent significant
(99%) hits to blocks BL01032C,E,G,H, Protein phosphatase 2C proteins.

ProDom Summary:  Protein Domain Search
Residues 1-260 constitute a defined domain of Y108_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 8 to 247 (E-value = 2.1e-06) place MG108 in the PP2C family which is described as Protein phosphatase 2C (PF00481)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
109  
129

PDB Hit:


Gene Protein Sequence:
MQAANDHFFTGLSKKGPVRKENQDFYGFSFNQNNLLIVVCDGLGGYKGGK
IASNLVGKLFLSLFEGFEFNQWDETTVKKWFENTLIQARFQLENCFQTVY
EAQIQFARMASTLVLGILTKSDIYIFWIGDSRAYLLFENQAKLVTKDHNL
YNQLVAMNADEKLLLSYSNQLLALTNTISKETKRPLVYGFYNTKIEQQEF
LLLCSDGLYNFVEKELFFEIITNSKNLKQAVFNLYRKSIENASNDNITAA
LVNLQKWKQS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGCTGCTAATGATCATTTCTTTACCGGTTTATCAAAAAAAGGTCC
TGTAAGAAAGGAAAATCAGGACTTTTATGGATTTAGTTTTAATCAAAATA
ACCTACTAATAGTTGTTTGTGATGGTCTTGGTGGTTATAAGGGTGGCAAG
ATTGCTAGTAACTTAGTAGGTAAACTCTTTCTTAGTTTATTTGAAGGTTT
TGAATTTAACCAGTGAGATGAAACTACAGTTAAAAAGTGGTTTGAAAATA
CTTTAATACAAGCACGCTTTCAACTAGAAAATTGTTTTCAAACAGTTTAT
GAAGCACAAATCCAGTTTGCTAGGATGGCTAGCACCTTGGTCTTGGGAAT
TTTAACTAAAAGTGATATTTATATCTTTTGAATTGGTGATTCCAGAGCTT
ACTTATTATTTGAAAACCAAGCTAAGTTAGTTACTAAGGATCACAATCTT
TATAACCAGTTAGTTGCTATGAATGCTGATGAGAAATTACTTTTAAGTTA
TTCTAATCAACTTTTAGCATTAACAAATACTATTTCCAAAGAAACAAAAA
GACCATTAGTTTATGGTTTTTATAACACAAAAATTGAACAACAAGAATTT
TTATTATTGTGTTCTGATGGACTTTATAACTTTGTTGAAAAAGAGCTTTT
TTTTGAAATTATCACTAATTCTAAAAACCTAAAACAAGCAGTGTTTAATC
TTTATAGAAAAAGTATTGAAAATGCAAGTAATGATAATATTACTGCTGCC
CTTGTTAATCTGCAAAAATGGAAGCAATCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy