Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR76 IGR75 IGR79 IGR77 IGR78 IGR74 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 trxB, - MG102 pkn, - MG109 pgiB, - MG111 vacB, - MG104 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 trxB, - MG102 pkn, - MG109 pgiB, - MG111 vacB, - MG104 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 pkn, - MG109 pgiB, - MG111 vacB, - MG104 cfxEc, - MG112 MG103 cfxEc, - MG112 MG103 trxB, - MG102
* Calculated from Protein Sequence

Gene ID: MG107

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gmk  

Definition:
guanylate kinase

Gene Start:
134558

Gene Stop:
135334

Gene Length:
777

Molecular Weight*:
29587

pI*:
9.86

Net Charge*:
8.59

EC:
2.7.4.8  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Comment:
This protein is essential for recycling GMP and, indirectly, cGMP. See Prosite PDOC00670.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to guanylate kinase
proteins. For example residues 21-258 are 68% similar to KGUA_MYCPN,
5'guanylate kinase of Mycoplasma pneumoniae,(AE000057). In addition,
residues 73-257 are 43% similar to KGUA_HAEIN, 5'guanylate kinase
homolog of Haemophilus influenzae,(U32848).
Residues 76-257 are 35% similar to CT030, guanylate kinase of C.
trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0194 is ehgpc-y.
COG name: Guanylate kinase.
Functional Class: F
BeTs to e-g-c-y.

Blocks Summary:  Blocks Search
Residues 79-91, 107-127, and 135-182 represent significant (100%) hits
to blocks BL00856A,B,C, Guanylate kinase proteins. Residues 77-92
represent a significant (99%) hit to block PR00364A, DISEASE RESISTANCE
PROTEIN SIGNATURE. Residues 76-97 represent a significanbt (99%) hit
to block PR00449A, TRANSFORMING PROTEIN P21 RAS SIGNATURE. Residues
13-32 and 75-100 represent significant (95%) hits to blocks PR00193A,B,
MYOSIN HEAVY CHAIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 1-77, 91-135, 136-207, and 229-257 constitute defined domains
of KGUA_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 111 to 216 (E-value = 3.4e-58) place MG107 in the Guanylate_kin family which is described as Guanylate kinase (PF00625)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
13  
44
coil-coil  
199  
259

PDB Hit:
gi|494043|pdb|1GKY| Guanylate Kinase (E.C.2.7.4.8) Complex With Guanosine Monophosphate

Gene Protein Sequence:
MSYSCALPSYEASTYAIIFLIQVSICSSIGKLTASVGLLIKALSSKTSQV
LVGWKVIDKNSKVKIILTIEVNNQGRIFVITGPSGVGKSTLVKALLDHFK
EQLFYSISATTRKKRISEKEGIDYFFKDKDEFENLIKQDAFIEWACYNNH
YYGTLKSQAEQAIKSGINLMLEIEYQGALQVKSKYPHNVVLIFIKPPSMQ
ELLKRLKKRNDEDETTIKKRLEQAKIEFQQIDNFKYVVTNKEFDKTLNEL
KSILLSEFI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATATTCTTGTGCTTTACCATCATATGAAGCATCAACATATGCAAT
CATCTTTTTAATACAGGTTTCAATTTGCTCATCTATTGGAAAATTAACAG
CTTCAGTTGGCTTGTTAATCAAAGCATTATCATCAAAAACAAGCCAAGTT
TTAGTTGGTTGAAAAGTCATTGATAAAAACAGTAAAGTTAAAATTATTCT
AACAATTGAAGTGAACAATCAGGGGAGAATTTTTGTCATTACTGGTCCTA
GCGGTGTTGGCAAAAGCACCCTTGTTAAAGCCTTATTAGATCATTTCAAA
GAACAACTGTTCTACAGTATCTCTGCAACTACAAGAAAAAAGCGCATTAG
TGAAAAAGAGGGAATTGATTATTTTTTTAAAGATAAAGATGAGTTTGAAA
ACTTAATAAAACAAGATGCTTTCATTGAATGGGCTTGCTATAATAACCAT
TATTATGGAACGCTCAAGTCTCAAGCTGAACAAGCAATTAAAAGCGGAAT
TAATTTAATGCTTGAAATTGAGTATCAAGGTGCTTTACAGGTTAAAAGTA
AATATCCTCATAACGTTGTTTTAATTTTCATTAAACCACCTTCAATGCAA
GAGTTGTTAAAACGTTTAAAAAAGCGTAATGATGAAGATGAAACCACAAT
TAAAAAACGTTTAGAACAAGCTAAGATAGAGTTTCAACAGATTGATAATT
TTAAGTATGTTGTCACTAACAAAGAGTTTGATAAAACCCTTAATGAGTTG
AAATCAATCTTACTATCTGAGTTTATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy