Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR76 IGR75 IGR79 IGR77 IGR78 IGR74 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 trxB, - MG102 pkn, - MG109 pgiB, - MG111 vacB, - MG104 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 trxB, - MG102 pkn, - MG109 pgiB, - MG111 vacB, - MG104 pdf,def, - MG106 MG105 MG110 gmk, - MG107 ptc1, - MG108 trxB, - MG102 pkn, - MG109 pgiB, - MG111 vacB, - MG104 cfxEc, - MG112 MG103 cfxEc, - MG112 MG103
* Calculated from Protein Sequence

Gene ID: MG106

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pdf  def  

Definition:
formylmethionine deformylase (polypeptide deformylase)

Gene Start:
134826

Gene Stop:
134149

Gene Length:
678

Molecular Weight*:
26144

pI*:
8.82

Net Charge*:
4.77

EC:
3.5.1.31  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Amino Acid Metabolism; Methionine metabolism
Carbohydrate Metabolism; Glyoxylate and dicarboxylate metabolism

Comment:
This protein removes the formyl group from the N-terminal Met of newly
synthesized proteins.

There is a 3D structure for the E. coli protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to formylmethionine
deformylase proteins. For example residues 11-225 are 68% similar
tp DEF_MYCPN, polypeptide deformylase of Mycoplasma pneumoniae,
(AE000057). In addition residues 43-213 are 36% similar to
N-formylmethionylaminoacyl-tRNA deformylase of Bacillus stearothermophilus,
(Y10549). Residues 93-203 are 32% similar to residues 41-143 of TP0757,
polypeptide deformylase of T. pallidum. Residues 93-203 are 27% similar
to CT353, polypeptide deformylase of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0242 is ehgpc--.
COG name: N-formylmethionyl-tRNA deformylase.
Functional Class: J
BeTs to e-g-c--.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-171, 172-205, and 206-226 constitute defined domains of
DEF_MYCGE. Also residues 93-167 are 33% similar to formylmethionine
deformylase as represented by DEF_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 40 to 208 (E-value = 3.1e-102) place MG106 in the Pep_deformylase family which is described as Polypeptide deformylase (PF01327)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
15  
36

PDB Hit:
gi|2098360|pdb|1DEF| Peptide Deformylase Catalytic Core (Residues 1 - 147), Nmr, 9 Structures Hydrolase, Zinc Metalloprotease Mol_id: 1; Molecule: Peptide Deformylase; Chain: Null; Fragment: Active Catalytic Core, Residues 1 - 147; Ec: 3.5.1.31; Engineer

Gene Protein Sequence:
VLLPTPLGPVMTKILPWLFTSIVRIILTLLFLSMTFQPTKTWLVFDDNAL
INKPTEAVNFPIDEQIETCIKKMIAYVDASYDGKAQEYDIIPGIGIAANQ
IGYWKQLFYIHLNDLNKEKKCLLINPKIIDQSENKAFLESGEGCLSVKKQ
HKGYVIRSEWITIKGYDWFEKKEITIKATGLFGMCLQHEFDHLQGRFFYQ
RINPLNPWFKKPEWKVINPTLKTSNG

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTTTGCCAACACCGCTAGGACCAGTAATGACAAAAATTCTCCCCTG
ATTGTTCACTTCAATTGTTAGAATAATTTTAACTTTACTGTTTTTATCAA
TGACTTTTCAACCAACTAAAACTTGGCTTGTTTTTGATGATAATGCTTTG
ATTAACAAGCCAACTGAAGCTGTTAATTTTCCAATAGATGAGCAAATTGA
AACCTGTATTAAAAAGATGATTGCATATGTTGATGCTTCATATGATGGTA
AAGCACAAGAATATGACATTATTCCAGGAATTGGGATAGCTGCTAACCAG
ATTGGCTATTGAAAACAACTGTTTTACATCCACCTCAATGATTTAAACAA
AGAAAAAAAGTGCCTACTGATCAATCCTAAAATTATTGATCAAAGTGAAA
ATAAAGCATTTTTAGAAAGTGGTGAGGGGTGTTTAAGTGTTAAAAAGCAG
CACAAAGGTTATGTAATTCGTAGTGAATGGATCACTATTAAAGGTTATGA
TTGGTTTGAAAAAAAAGAGATTACCATTAAAGCAACTGGACTATTTGGAA
TGTGTTTACAGCATGAATTTGATCACTTACAGGGACGCTTTTTTTACCAA
AGAATTAACCCTTTGAATCCATGGTTTAAAAAACCAGAATGAAAAGTGAT
TAATCCTACTTTGAAGACAAGTAATGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy