Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR73 IGR75 IGR74 pdf,def, - MG106 MG105 gmk, - MG107 trxB, - MG102 gluA,gatA, - MG099 p48, - MG098 vacB, - MG104 pdf,def, - MG106 MG105 gmk, - MG107 trxB, - MG102 gluA,gatA, - MG099 p48, - MG098 vacB, - MG104 pdf,def, - MG106 MG105 gmk, - MG107 trxB, - MG102 gluA,gatA, - MG099 p48, - MG098 vacB, - MG104 MG103 gatB, - MG100 MG103 gatB, - MG100 MG101 MG101
* Calculated from Protein Sequence

Gene ID: MG102

DNA Molecule Name:
1  

Genbank ID:
3844690

Gene Name:
trxB  

Definition:
thioredoxin reductase

Gene Start:
129347

Gene Stop:
130291

Gene Length:
945

Molecular Weight*:
34660

pI*:
7.42

Net Charge*:
1.02

EC:
1.6.4.5  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme and porphyrin  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Primary Evidence:
Ben-Menachem G, Himmelreich R, Herrmann R, Aharonowitz. 1997. The thioredoxin reductase system of mycoplasmas. Microbiology 143 (Pt 6):1933-40. Medline: 9202470.

Comment:
Catalysis of reduction of oxidized thioredoxin by NADPH.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to thioredoxin reductase
proteins. For example residues 1-313 are 67% similar to TRXB_MYCPN,
thioredoxin reductase of Mycoplasma pneumoniae,(AE000058). In
addition, residues 9-304 are 39% similar to residues 1-295 of
thioredoxin reductase of Listeria monocytogenes,(AF009622).
Residues 18-288 are 24% similar to residues 199-488 of
TP0735, glutamate synthase of T. pallidum. Residues 18-309 are 31%
similar to residues 45-343 of CT099, thioredoxin reductase and residues
16-292 are 22% similar to residues 5-311 of CT557, lipoamide dehydrogenase
component (E3) of pyruvate dehydrogenase of C. trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0492 is EhgpcmYU.
COG name: Thioredoxin reductase.
Functional Class: O
BeTs to -hg-cmyu.

Blocks Summary:  Blocks Search
Residues 20-41, 160-181, 50-64, 115-132, 140-184, 141-185, 0-44, 40-66,
278-315, and 137-174 represent significant hits to blocks
BL00573A,B,C,D,E,F, Pyridine nucleotide-disulphide oxidoreductases class-II.

ProDom Summary:  Protein Domain Search
Residues 19-287, 52-103, and 118-256 constitute defined domains of
TRXB_MYCGE. Also residues 257-290 are 20% similar to YPDA_BACSU,
a hypothetical protein.

Paralogs:  Local Blast Search
This protein is paralogously related to MG271, dihydrolipoamide
dehydrogenase. Residues 16-292 are 24% similar to residues 3-307 of
MG271.

Pfam Summary:  Pfam Search
Residues 17 to 299 (E-value = 1.3e-55) place MG102 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)

PDB Hit:
gi|809432|pdb|1TDE| Thioredoxin Reductase (E.C.1.6.4.5) (Wild Type)

Gene Protein Sequence:
MLKVNADFLTKDQVIYDLVIVGAGPAGIASAIYGKRANLNLAIIEGNTPG
GKIVKTNIVENYPGFKTITGPELGLEMYNHLLAFEPVVFYNNLIKIDHLN
DTFILYLDNKTTVFSKTVIYATGMEERKLGIEKEDYFYGKGISYCAICDA
ALYKGKTVGVVGGGNSAIQEAIYLSSIAKTVHLIHRREVFRSDALLVEKL
KKISNVVFHLNATVKQLIGQEKLQTVKLASTVDKSESEIAIDCLFPYIGF
ESNNKPVLDLKLNLDQNGFILGDENMQTNIKGFYVAGDCRSKSFRQIATA
ISDGVTAVLKVRDDI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTAAAGTGAATGCTGATTTTTTAACTAAAGATCAAGTTATCTATGA
TTTAGTGATAGTAGGTGCTGGCCCTGCTGGGATTGCTAGTGCCATTTATG
GTAAACGTGCTAACTTAAATTTAGCAATTATTGAAGGAAACACTCCAGGA
GGGAAGATAGTAAAAACTAACATTGTGGAAAACTATCCTGGTTTTAAAAC
CATAACTGGTCCTGAATTAGGTCTTGAGATGTACAACCACTTGTTAGCAT
TTGAACCAGTTGTTTTTTATAACAACTTAATCAAAATTGATCATCTTAAC
GATACATTCATCTTGTATTTAGATAACAAAACGACAGTTTTTAGCAAAAC
TGTTATCTATGCAACAGGGATGGAAGAGAGAAAACTTGGCATTGAAAAGG
AAGATTATTTTTATGGTAAAGGGATTAGTTATTGTGCTATTTGTGATGCG
GCTCTTTACAAAGGTAAAACAGTTGGTGTTGTAGGAGGAGGTAATTCTGC
AATACAGGAAGCAATTTATCTTTCAAGTATTGCTAAAACAGTTCACCTTA
TTCACAGACGTGAAGTGTTTAGAAGTGATGCATTACTAGTTGAAAAATTA
AAAAAAATTAGTAATGTAGTTTTTCATTTAAATGCTACTGTAAAACAGTT
AATAGGTCAAGAAAAGCTCCAAACTGTTAAATTGGCAAGCACAGTTGATA
AATCAGAAAGTGAAATTGCAATTGATTGTCTCTTTCCTTACATAGGCTTT
GAAAGTAATAACAAGCCAGTTTTAGATCTTAAGCTTAATTTAGATCAAAA
TGGTTTTATTTTAGGAGATGAAAATATGCAAACTAACATTAAGGGTTTTT
ATGTTGCTGGGGATTGTAGAAGTAAATCATTCCGGCAAATTGCCACTGCA
ATTAGTGATGGGGTAACAGCTGTTTTAAAGGTTAGGGATGACATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy