Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR73 IGR71 IGR72 IGR74 IGR70 ung, - MG097 trxB, - MG102 gluA,gatA, - MG099 p48, - MG098 MG096 vacB, - MG104 ung, - MG097 trxB, - MG102 gluA,gatA, - MG099 p48, - MG098 MG096 vacB, - MG104 Type: inverted, Name:  - 58 ung, - MG097 trxB, - MG102 gluA,gatA, - MG099 p48, - MG098 MG096 vacB, - MG104 MG103 gatB, - MG100 MG103 gatB, - MG100 MG101 MG101
* Calculated from Protein Sequence

Gene ID: MG099

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gluA  gatA  

Definition:
amidase (glu-tRNA amidotransferase, subunit A)

Gene Start:
125852

Gene Stop:
127282

Gene Length:
1431

Molecular Weight*:
53364

pI*:
8.17

Net Charge*:
3.28

EC:
3.5.1.4  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism
Amino Acid Metabolism; Phenylalanine metabolism
Amino Acid Metabolism; Tryptophan metabolism
Metabolism of Other Amino Acids; Cyanoamino acid metabolism

Comment:
Reaction for amidase:
A MONOCARBOXYLIC ACID AMIDE + H(2)O = A MONOCARBOXYLATE + NH(3).

Disruption of this operon is lethal. This demonstrates that
transamidation is the only pathway to Gln-tRNA in B. subtilis and
that glutamyl-tRNA amidotransferase is a novel and essential
component of the translational apparatus.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Glu-tRNA amidotransferase subunit A
and amidases sequences, e.g. residues 1-477 are 63% similar to AMID_MYCPN.
MG099 is similar to T.pallidum TP1020, a glu-tRNA
amidotransferase, subunit A. It is also similar to C.trachomatis
amidotransferase A sequence CT003.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0154 is --gpcmy.
COG name: Glu-tRNAGln amidotransferase A subunit.
Functional Class: J
BeTs to g,c,m,y.

Blocks Summary:  Blocks Search
Residues 132-183 are members of block BL00571(Amidases proteins).
Residues 211-222, 94-112 are matched to blocks PR00110B,D,
concerned with Alpha-amylase signatures, e.g. AMY_BACLI.

ProDom Summary:  Protein Domain Search
Residues 243-477, 88-185, 1-61, 62-87 constitute defined
domains of AMID_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 21 to 462 (E-value = 9.7e-161) place MG099 in the Amidase family which is described as Amidase (PF01425)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
101

PDB Hit:


Gene Protein Sequence:
VRSNILSLRAILDKKPSAINDVLTSINAKIELNKSSNFLLKNTVEIYSKK
INKSDEKILLNNIPYVLKDNIATKDIVTTGGSLFLKNYLPPFSATVFELL
EMNGALLVGKANMDEFGLGGTGSYSAFGVVHHPENSSLIAGGSSSGSAYA
VAKDIVPFSIATDTGDSIRRPASICNVVGFKPTYGLISRNGVFPYAPSMD
HVGIFAKFVSDIAIVSDVVIKHDKTDFSSQKSPDENQFFNELAIPFTRSI
RFGYLKPLEKLFNKHLQKKWNNLKKTLEQKNYQLIPLDFDVELLKVIDSI
YKIISYSEAVSCYSNLTGIVFGQKVFEPNSPSNFDQTITRNRDQFLGKQL
KRRFVIGAFATDEKNFEKYFEKAQKIRRVLVDNFLNLFSDVDFVLSPSAS
CFASTIEDIQANKPYTNIIDDFLQLANFAGSPSITIPWLVQTKDQTIGLS
ISANCFEDKKLLQIAYWFEQLFDLNHD

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGATCAAATATTTTAAGTCTCAGGGCGATACTTGATAAAAAACCTAG
TGCCATTAACGATGTTTTAACATCAATTAATGCAAAGATAGAACTGAATA
AATCAAGTAATTTTTTATTGAAAAATACTGTTGAAATTTATTCAAAAAAA
ATTAATAAAAGTGATGAAAAGATTCTGCTAAATAACATCCCTTATGTTTT
GAAAGATAACATCGCTACTAAAGATATTGTCACCACTGGTGGTTCTTTGT
TTTTAAAAAACTATCTTCCCCCTTTTTCAGCAACTGTGTTTGAACTGTTA
GAAATGAATGGCGCGTTGCTTGTTGGTAAAGCTAATATGGATGAATTTGG
CTTAGGTGGAACAGGTAGTTATTCTGCTTTTGGTGTTGTTCATCACCCTG
AAAATTCCAGTTTAATTGCAGGTGGTTCTTCCTCAGGTTCAGCTTACGCA
GTTGCTAAAGACATTGTTCCTTTTTCCATTGCAACTGACACTGGTGATTC
GATTAGAAGACCTGCTAGTATCTGTAATGTTGTTGGCTTTAAACCAACTT
ATGGTTTGATATCACGTAATGGGGTATTTCCATATGCCCCAAGTATGGAC
CATGTGGGGATATTTGCTAAGTTTGTTAGTGATATTGCCATTGTTAGTGA
TGTTGTTATTAAACATGATAAAACTGATTTTTCTTCCCAAAAATCACCTG
ATGAAAACCAGTTTTTCAATGAGTTGGCCATTCCCTTTACAAGATCAATT
CGCTTCGGTTATTTAAAACCACTAGAAAAACTGTTTAACAAACACCTCCA
AAAAAAATGAAATAATCTCAAAAAAACCTTAGAACAAAAAAACTACCAGT
TGATTCCACTTGATTTTGATGTGGAACTTCTCAAAGTAATTGATTCTATT
TACAAAATAATTAGTTATAGCGAAGCAGTTAGTTGTTATAGTAATTTAAC
TGGCATTGTCTTTGGTCAAAAGGTGTTTGAACCTAATTCACCAAGTAATT
TTGATCAAACTATTACCAGAAACAGAGATCAGTTTTTAGGTAAACAACTA
AAAAGAAGATTTGTAATAGGGGCATTTGCAACTGATGAGAAGAATTTTGA
AAAGTACTTTGAAAAAGCTCAGAAAATAAGAAGAGTCTTAGTGGATAACT
TTCTGAATCTCTTTAGTGATGTTGATTTTGTATTATCACCAAGCGCTTCT
TGTTTTGCTAGTACCATTGAAGATATTCAAGCTAATAAGCCATATACAAA
CATTATTGATGACTTTTTACAATTAGCTAATTTTGCTGGTAGCCCTTCTA
TAACTATCCCTTGGTTAGTTCAAACAAAAGACCAAACAATTGGTTTAAGT
ATTAGTGCTAACTGTTTTGAAGATAAAAAACTCTTACAAATTGCTTATTG
ATTTGAACAACTTTTTGATTTAAACCATGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy