Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR73 IGR69 IGR71 IGR72 IGR70 ung, - MG097 trxB, - MG102 MG095 dnaB, - MG094 gluA,gatA, - MG099 p48, - MG098 MG096 ung, - MG097 trxB, - MG102 MG095 dnaB, - MG094 gluA,gatA, - MG099 p48, - MG098 MG096 Type: inverted, Name:  - 58 ung, - MG097 trxB, - MG102 MG095 dnaB, - MG094 gluA,gatA, - MG099 p48, - MG098 MG096 gatB, - MG100 gatB, - MG100 MG101 MG101
* Calculated from Protein Sequence

Gene ID: MG098

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
p48  

Definition:
conserved hypothetical protein (possible glu-tRNA amidotransferase, subunit C)

Gene Start:
124416

Gene Stop:
125846

Gene Length:
1431

Molecular Weight*:
54035

pI*:
10.49

Net Charge*:
19.11

EC:
6.3.5.-  

Functional Class:
Translation; tRNA modification  
Unknown  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Disruption of glu-tRNA amidotransferase operon is lethal. This demonstrates that
transamidation is the only pathway to Gln-tRNA in B. subtilis and
that glutamyl-tRNA amidotransferase is a novel and essential
component of the translational apparatus.

Blast Summary:  PSI-Blast Search
Only ortholog detected was to Y098_MYCPN(hypothetical
protein MG098 homolog): residues 10-477 are 63% similar
to this sequence.
MG098 shows no significant similarities to T.pallidum
and C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0721 is .
COG name: Glu-tRNAGln amidotransferase C subunit.
Functional Class: J
No related COGs was found when search was performed.

Blocks Summary:  Blocks Search
Residues 9-243 represent 6 matches to blocks PR00702C,D,F,
concerned with acriflavin resistance protein family signatures
, e.g. D908756.
Residues 17-345 represent 14 matches to blocks PR00699A-F,
concerned with C.ELEGANS integral membrane protein SRG
signatures, e.g. SRB8_CAEEL.

ProDom Summary:  Protein Domain Search
Residues 1-477 constitute defined domain of Y098_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 405 to 477 (E-value = 1.5e-32) place MG098 in the Glu-tRNAGln family which is described as Glu-tRNAGln amidotransferase C subunit (PF02686)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
16  
43
transmembrane  
57  
85
transmembrane  
91  
123
transmembrane  
127  
158
transmembrane  
168  
194
transmembrane  
216  
248
transmembrane  
276  
308
transmembrane  
320  
353

PDB Hit:


Gene Protein Sequence:
MGEIKNTAPTSDISTSGFIYFAVVFLIIIVYLFFKNILFLFFFKRYPKNT
PKIGVSNITTIAMIIAVAVSVVLVLMALAGGLTAALFRGYPGFRVTLELI
LVKISGLLFGPIIGIFSAATIDFLTVIFSGGVFNIGYVLGAILTGMIAGI
LREVLISTSFLNNKTLSDFAYLVLSVGMVFASFLVTQFFVISVTQNLSAF
QSNDQIVLRFNASPLNFSISLQRYVQIIFYFAMVVIITMVVLYFVWIIKQ
KHFNYAYSKFFFRRYKHANHQFTLFVLTKENWFYLILNVITLATTSLLMI
NIAFIPIFDTQTTGQTYDFWLLVRLLFAPLIFLLDIIVIYPILLLLTPIM
LKGFKTVASETQTKGIKKSFSDMQSLIMPNVISHKKQQLIRKEMQQLAKT
IRIDLSDKEVDALVEEFKEITKSFNKVTKIDTTNVQPMYAPFEFSPTPLR
KDKPVVDKHAKQLLNNCCEVKTGFVKV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGAGAGATTAAAAATACTGCACCAACAAGCGATATTTCCACTTCAGG
ATTTATCTATTTTGCAGTTGTTTTTCTAATCATTATAGTCTATCTTTTTT
TTAAAAACATTCTCTTTTTGTTCTTCTTTAAAAGATATCCTAAAAACACA
CCTAAAATTGGGGTTAGCAATATTACTACTATTGCTATGATTATTGCTGT
TGCTGTATCTGTTGTTTTGGTCTTAATGGCTTTAGCAGGGGGGTTAACAG
CAGCGCTGTTCCGTGGTTATCCTGGGTTCCGTGTTACCTTAGAGTTAATT
CTAGTGAAGATTTCAGGACTTTTATTTGGTCCTATAATTGGTATTTTTTC
AGCAGCTACCATTGACTTTTTAACTGTTATTTTTTCAGGTGGGGTGTTTA
ATATTGGTTATGTTTTAGGAGCAATCCTAACGGGAATGATTGCTGGAATT
TTACGTGAAGTTTTAATTTCAACTTCTTTTTTAAATAACAAAACTTTAAG
TGATTTTGCCTATCTTGTTTTATCAGTGGGGATGGTATTTGCCAGTTTTT
TAGTAACCCAGTTTTTTGTTATCTCAGTTACCCAAAACTTATCAGCATTT
CAAAGTAATGATCAAATTGTTTTACGTTTTAACGCCTCACCTTTAAATTT
CAGTATCTCATTGCAAAGATATGTTCAAATTATTTTCTATTTTGCGATGG
TTGTAATCATCACAATGGTAGTACTTTACTTTGTTTGAATAATCAAGCAA
AAGCACTTTAACTATGCTTATTCCAAGTTTTTCTTTCGTAGATATAAACA
TGCTAATCACCAATTTACCTTATTTGTGTTAACAAAAGAAAACTGGTTTT
ATCTAATTCTGAATGTAATTACATTAGCAACCACCAGTTTGCTAATGATT
AACATTGCATTTATTCCTATCTTTGATACCCAAACAACTGGACAAACTTA
TGATTTTTGATTATTAGTTAGATTATTGTTTGCTCCTTTGATCTTCTTAC
TTGATATTATTGTTATCTATCCAATCTTGTTATTGTTAACCCCAATCATG
TTAAAAGGGTTTAAAACAGTAGCATCAGAAACCCAAACAAAAGGAATCAA
AAAGAGTTTTTCAGATATGCAAAGCTTAATTATGCCCAATGTTATTAGTC
ACAAAAAACAGCAGTTAATTAGAAAAGAGATGCAACAGTTAGCAAAAACA
ATCAGAATTGATTTATCAGACAAAGAAGTGGATGCACTTGTTGAAGAGTT
TAAAGAGATCACAAAGAGTTTTAATAAGGTAACTAAAATTGATACCACTA
ATGTTCAACCGATGTACGCTCCATTTGAATTTAGTCCAACCCCACTAAGA
AAAGATAAACCAGTAGTTGATAAACACGCTAAGCAACTACTTAATAACTG
TTGTGAAGTTAAAACAGGTTTTGTAAAGGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy