Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR73 IGR69 IGR71 IGR72 IGR70 MG101 ung, - MG097 MG095 dnaB, - MG094 gluA,gatA, - MG099 p48, - MG098 MG096 MG101 ung, - MG097 MG095 dnaB, - MG094 gluA,gatA, - MG099 p48, - MG098 MG096 Type: inverted, Name:  - 58 ung, - MG097 MG095 dnaB, - MG094 gluA,gatA, - MG099 p48, - MG098 MG096 gatB, - MG100 gatB, - MG100 MG101
* Calculated from Protein Sequence

Gene ID: MG097

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ung  

Definition:
uracil DNA glycosylase

Gene Start:
123579

Gene Stop:
124313

Gene Length:
735

Molecular Weight*:
28141

pI*:
9.96

Net Charge*:
7.81

EC:
3.2.2.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous enzymes

Comment:
See Prosite PDOC00121.

From Prosite:

Uracil-DNA glycosylase (EC 3.2.2.-) (UNG) [1] is a DNA repair enzyme that
excises uracil residues from DNA by cleaving the N-glycosylic bond. Uracil in
DNA can arise as a result of misincorportation of dUMP residues by DNA
polymerase or deamination of cytosine.

The sequence of uracil-DNA glycosylase is extremely well conserved [2] in
bacteria and eukaryotes as well as in herpes viruses. More distantly related
uracil-DNA glycosylases are also found in poxviruses [3].

[ 1] Sancar A., Sancar G.B.
Annu. Rev. Biochem. 57:29-67(1988).
[ 2] Olsen L.C., Aasland R., Wittwer C.U., Krokan H.E., Helland D.E.
EMBO J. 8:3121-3125 (1989).
[ 3] Upton C., Stuart D.T., McFadden G.
Proc. Natl. Acad. Sci. U.S.A. 90:4518-4522(1993).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Uracil DNA glycosylase protein
sequences, e.g. residues 3-233 are 54% similar to UNG_MYCPN.
MG097 is similar to C.trachomatis Uracil-DNA glycosylase
sequence CT607. It shows no significant similarities to
T.pallidum sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0692 is ehgp--y.
COG name: Uracil DNA glycosylase.
Functional Class: L
BeTs to h,g,y.

Blocks Summary:  Blocks Search
Residues 65-75, 93-103, 124-151, 194-204, 210-233 are matched
to blocks BL00130A-F, concerned with Uracil-DNA glycosylase
protein sequences, e.g. UNG_BACSU, UNG_ECOLI.



ProDom Summary:  Protein Domain Search
Residues 29-182, 183-245 constitute defined domains of UNG_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 59 to 224 (E-value = 7.5e-43) place MG097 in the UDG family which is described as Uracil DNA glycosylase superfamily (PF03167)

PDB Hit:
gi|2392165|pdb|1AKZ| Human Uracil-Dna Glycosylase Glycosylase, Dna Repair, Uracil Removal From Dna, Alpha Beta Protein, Glycosidase Mol_id: 1; Molecule: Uracil-Dna Glycosylase; Chain: Null; Synonym: Udg, Ung; Ec: 3.2.2.-; Engineered: Yes; Mutation: P82m,

Gene Protein Sequence:
VVMDDLFQRMVSCVLPSWRAFIDEEVKKPYFQALLEKLKALKATIIPKPE
LIFRVFSFFKPIDTKVIIFGQDPYPSPNDACGLAFASNNSKTPASLKRII
LRLEKEYPSLKQESSWQQNFLLNWAEQGVLLLNGILTTTVFIRNAHKNWG
WEEFNCNLLTFLKNQNIKPLLVFLGVQTKNFVVKSIGNVDGFEHLSYPHP
SPLSGNLFLTNPNDLFKTINNWLKQHNQKIINWAVVKNASFDQLS

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTAATGGATGATCTATTCCAAAGAATGGTTAGCTGTGTTCTACCGTC
ATGAAGAGCTTTTATTGATGAGGAAGTTAAAAAACCTTATTTTCAAGCTT
TATTAGAAAAATTAAAGGCTTTAAAAGCAACAATAATTCCAAAACCAGAA
CTTATTTTCCGTGTTTTTAGCTTCTTTAAGCCAATTGATACAAAGGTAAT
TATCTTTGGTCAAGATCCCTATCCTAGTCCTAATGATGCTTGTGGACTTG
CTTTTGCATCCAATAATTCCAAAACCCCTGCCAGCTTAAAAAGAATAATT
TTACGTTTAGAAAAAGAATATCCTTCGCTTAAACAAGAAAGTAGTTGACA
ACAAAACTTCCTATTGAATTGAGCAGAACAGGGCGTTTTATTACTAAATG
GAATTTTAACAACTACTGTATTTATACGCAACGCCCATAAAAATTGGGGT
TGGGAGGAGTTTAACTGTAATTTGCTAACTTTTCTAAAAAATCAAAACAT
TAAACCGCTGTTGGTATTTCTGGGTGTTCAAACTAAAAACTTTGTTGTTA
AGAGTATTGGTAATGTTGATGGATTTGAGCATTTATCATATCCCCATCCC
TCACCACTAAGTGGTAATTTGTTTCTAACAAACCCTAACGATCTGTTTAA
AACAATTAACAATTGGTTGAAACAACATAACCAAAAAATAATTAACTGAG
CAGTTGTTAAAAATGCTAGTTTTGACCAATTAAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy