Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR60 IGR59 IGR66 IGR61 IGR64 IGR63 IGR62 IGR65 IGR58 rpL11, - MG081 rpS12, - MG087 rpS7, - MG088 ssb, - MG091 rpS6, - MG090 rpL1, - MG082 MG084 lgt, - MG086 fus, - MG089 oppF, - MG080 rpL11, - MG081 rpS12, - MG087 rpS7, - MG088 ssb, - MG091 rpS6, - MG090 rpL1, - MG082 MG084 lgt, - MG086 fus, - MG089 oppF, - MG080 rpL11, - MG081 rpS12, - MG087 rpS7, - MG088 ssb, - MG091 rpS6, - MG090 rpL1, - MG082 MG084 lgt, - MG086 fus, - MG089 oppF, - MG080 rpS18, - MG092 pth, - MG083 ptsK,hprK, - MG085 pth, - MG083 ptsK,hprK, - MG085 rpS18, - MG092
* Calculated from Protein Sequence

Gene ID: MG086

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lgt  

Definition:
prolipoprotein diacylglyceryl transferase

Gene Start:
112718

Gene Stop:
113863

Gene Length:
1146

Molecular Weight*:
44419

pI*:
10.26

Net Charge*:
12.09

EC:
2.4.99.-  

Functional Class:
Fatty acid and phospholipid metabolism; Biosynthesis  

Pathway: pathway table
Metabolism of Complex Lipids; Sphingoglycolipid metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to prolipoprotein diacylglyceryl transferase
and its related sequences, e.g. residues 2-379 are 69% similar
to LGT_MYCPN.
MG086 shows very low similarity to T.pallidum TP0852,
a prolipoprotein diacylglyceryl transferase. It also shows
weak similarity to C.trachomatis prolipoprotein diacylglyceryl
transferase sequence CT252.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0682 is ehgpc--.
COG name: Prolipoprotein diacylglyceryltransferase.
Functional Class: M
BeTs to e,g,c.

Blocks Summary:  Blocks Search
Residues 130-159, 10-21, 161-183 are matched to blocks
BL00878A,E,H, concerned with Orn/DAP/Arg decarboxylases
family 2 pyridoxal-P attachment signatures, e.g. DCDA_BACSU.

ProDom Summary:  Protein Domain Search
Residues 1-138, 139-173, 174-382 constitute defined domains
of LGT_MYCGE. Residues 193-290 support this assignment,
e.g. LGT_STAAU.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 5 to 297 (E-value = 3.4e-79) place MG086 in the LGT family which is described as Prolipoprotein diacylglyceryl transferase (PF01790)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
18  
44
transmembrane  
50  
70
transmembrane  
91  
112
transmembrane  
141  
161
transmembrane  
214  
237
transmembrane  
243  
259
transmembrane  
273  
295
transmembrane  
299  
321

PDB Hit:


Gene Protein Sequence:
MNRPSWSTAFNIGGGFPIQWYGIIVSIGIIFAILMFVFKLIYCYKLQDNS
FYFFIFIAVLTMVLGARLWSFVIGDSNFANNNFFDFRNGGLAIQGGILLT
SIVGVIYFNFFLNSKTNKTKTIAELLNNKNEIKAVYVERNISVLVMLDLI
APCVLIGQAIGRWGNFFNQEVYGFALAGTMNDPQALANTQWGFLKILMPK
VWDGMWIDGQFRIPLFLIESFFNTIFFVLIYFVMDFIRGVKSGTIGFSYF
LATGIIRLILENFRDQTFYFQTSITTSILFIVVGILGIFYCQFIHVKLRN
YFWTYFFLYAFYKVAAFFTTLFLNNRKQMAQQKFAFYEKSLPNKKRSFFE
MKYYNDVTTPKIYRLTDQEMKLFDKLEAVTTS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAGACCAAGTTGATCAACTGCATTTAATATTGGTGGTGGATTTCC
CATCCAGTGGTATGGGATCATTGTCTCAATTGGCATTATTTTTGCCATTT
TAATGTTTGTCTTTAAACTGATTTATTGTTACAAATTACAAGACAACAGT
TTTTATTTTTTTATCTTTATTGCTGTTTTAACGATGGTTTTAGGCGCTCG
CCTCTGGTCATTTGTAATTGGTGATTCCAATTTTGCTAACAACAATTTCT
TTGATTTTCGTAACGGTGGATTGGCCATTCAGGGTGGGATTTTGTTAACC
AGTATTGTCGGAGTAATCTATTTCAACTTCTTTTTAAATAGTAAGACCAA
TAAAACCAAAACGATTGCTGAATTACTGAATAATAAGAATGAAATAAAAG
CTGTTTATGTTGAAAGAAATATCTCTGTTCTAGTGATGTTAGATCTGATT
GCTCCTTGTGTTTTAATTGGTCAAGCAATTGGCAGATGGGGTAATTTTTT
CAACCAAGAAGTTTATGGGTTTGCTTTAGCTGGAACAATGAATGATCCCC
AAGCATTGGCTAATACCCAGTGGGGATTTTTAAAGATCTTAATGCCTAAG
GTTTGGGATGGGATGTGGATTGATGGTCAGTTTCGCATTCCGCTCTTTTT
AATTGAGTCATTTTTTAACACTATTTTCTTTGTGTTAATTTACTTTGTAA
TGGATTTTATTAGGGGAGTTAAAAGTGGCACAATTGGTTTTAGTTATTTT
CTTGCTACTGGAATCATTCGTTTAATCTTGGAAAACTTTAGAGACCAAAC
CTTTTATTTTCAAACTTCAATAACCACTAGTATTTTGTTTATTGTCGTTG
GTATTTTAGGAATTTTTTATTGCCAGTTTATCCATGTCAAATTAAGAAAT
TACTTCTGAACTTATTTCTTTCTTTATGCCTTTTATAAAGTAGCTGCTTT
TTTCACTACACTTTTTTTGAATAACAGAAAGCAAATGGCACAACAGAAGT
TTGCTTTTTATGAAAAATCACTTCCCAATAAGAAGCGTTCTTTTTTTGAA
ATGAAGTATTACAATGATGTAACAACACCCAAAATTTATCGTTTAACTGA
TCAGGAAATGAAGTTATTTGATAAATTAGAGGCAGTTACAACCAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy