Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR60 IGR59 IGR61 IGR64 IGR63 IGR62 IGR65 IGR58 rpL11, - MG081 rpS12, - MG087 rpS7, - MG088 rpS6, - MG090 rpL1, - MG082 MG084 lgt, - MG086 fus, - MG089 oppF, - MG080 rpL11, - MG081 rpS12, - MG087 rpS7, - MG088 rpS6, - MG090 rpL1, - MG082 MG084 lgt, - MG086 fus, - MG089 oppF, - MG080 rpL11, - MG081 rpS12, - MG087 rpS7, - MG088 rpS6, - MG090 rpL1, - MG082 MG084 lgt, - MG086 fus, - MG089 oppF, - MG080 pth, - MG083 ptsK,hprK, - MG085 pth, - MG083 ptsK,hprK, - MG085
* Calculated from Protein Sequence

Gene ID: MG085

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsK  hprK  

Definition:
probable HPr kinase

Gene Start:
111790

Gene Stop:
112722

Gene Length:
933

Molecular Weight*:
34672

pI*:
9.42

Net Charge*:
5.59

EC:
2.7.1.-  

Functional Class:
Regulatory functions  

Pathway: pathway table

Comment:
HPr kinase regulates carbohydrate uptake and metabolism by phosphorylating a serine of phosphoryl carrier protein (HPr) of the phosphenolpyruvate-dependent sugar phosphotransferase system(PTS).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to HPr(SER) kinase and its related sequences,
e.g. residues 1-311 are 33% similar to HPRK_BACSU.
MG085 is similar to T.pallidum TP0591, a HPr kinase.It
shows no significant similarities to C.trachomatis sequences.

COGS Summary:  COGS Search
NONE.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 1-311 constitute defined domain of Y085_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 311 (E-value = 6.2e-227) place MG085 in the Hpr_kinase family which is described as HPr Serine kinase (PF02603)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
110  
217
coil-coil  
219  
246

PDB Hit:


Gene Protein Sequence:
MKHLTVKALVLQFNDCIQLIDGKNNIDNVITIPGLKRSVFELLGLFCKPI
GSVAILGKREFIFLNQKPVEQQKKIIANLLKLKPPAVILTKSFLDCGVLL
AVNQTYQVPILKTNLFSTELSFTVETYINEQFATVQKLHGVLLEIFGVGV
FLEGKSGIGKSESALDLINKNHLLIGDDAIEIYRLGNRLFGRAQALAKGF
MEIRGLGIINIERAYGLQITKEQTEIQLAISLLSLEEKNNASFERLGSDL
KLKNLLGVKISYYQIPISSGRKTSEIIESAVIDFKLKKSGYNSANEFILK
QRAMLEEQTDE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACATTTAACTGTCAAAGCATTAGTTTTGCAATTTAATGATTGTAT
CCAACTCATTGATGGTAAAAACAACATAGATAATGTGATTACTATCCCTG
GGTTAAAAAGGAGTGTTTTTGAACTATTAGGACTATTTTGTAAGCCAATT
GGTTCAGTTGCTATTTTAGGTAAACGTGAATTTATTTTTTTAAATCAAAA
GCCAGTTGAGCAACAGAAAAAGATTATTGCAAACCTCTTGAAACTCAAAC
CACCTGCAGTTATTCTAACCAAGTCATTTCTTGATTGTGGTGTTTTGTTA
GCTGTTAATCAAACTTATCAAGTTCCTATTTTAAAAACTAACTTGTTTTC
AACTGAACTCTCTTTTACTGTTGAAACCTATATTAACGAGCAATTTGCTA
CTGTTCAAAAGTTACATGGGGTTTTACTTGAAATCTTTGGTGTTGGGGTA
TTTTTAGAAGGAAAGAGTGGGATTGGTAAATCTGAAAGTGCTTTAGATTT
AATTAATAAAAACCACCTTCTAATAGGTGATGATGCTATTGAGATCTACA
GATTAGGCAATAGGTTATTTGGTAGAGCACAAGCACTGGCAAAAGGCTTT
ATGGAGATTAGAGGTCTTGGCATCATTAATATTGAACGTGCTTATGGGTT
ACAGATTACAAAAGAACAAACTGAAATCCAACTAGCAATTAGTTTGTTGA
GTTTAGAGGAGAAAAACAACGCTAGTTTTGAGCGCTTAGGCAGTGATTTA
AAACTAAAAAATCTGCTTGGGGTTAAGATTAGTTACTATCAGATCCCTAT
CTCTTCAGGTAGAAAAACAAGCGAAATTATTGAAAGTGCAGTAATCGATT
TTAAACTTAAGAAAAGTGGTTACAATTCAGCAAACGAGTTTATCTTAAAG
CAACGTGCCATGTTAGAAGAACAAACTGATGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy