Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR51 IGR50 rps2, - MG070 uvrB, - MG073 pacL, - MG071 ptsG, - MG069 rps2, - MG070 uvrB, - MG073 pacL, - MG071 ptsG, - MG069 rps2, - MG070 uvrB, - MG073 pacL, - MG071 ptsG, - MG069 secA, - MG072 secA, - MG072
* Calculated from Protein Sequence

Gene ID: MG071

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pacL  

Definition:
cation-transporting P-ATPase

Gene Start:
91924

Gene Stop:
94545

Gene Length:
2622

Molecular Weight*:
96280

pI*:
7.51

Net Charge*:
2.21

EC:
3.6.1.-  

Functional Class:
Transport and binding; Cations  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Folate biosynthesis
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:
E1-E2 ATPases (also known as P-type) are cation transport ATPases which form an aspartyl phosphate intermediate in the course of ATP hydrolysis.

See Prosite PDOC00139.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to cation-transporting P-ATPase sequences,
e.g. residues 1-874 are 68% similar to ATCL_MYCPN.
MG071 is similar to T.pallidum TP1036, a cation-transporting
ATPase, P-type.It is also similar to C.trachomatis metal
transporting P-type ATPase sequences CT727.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0474 is ehgpcmy.
COG name: Cation transport ATPases.
Functional Class: P
BeTs to g,c,m,y.

Blocks Summary:  Blocks Search
Residues 136-150, 284-323, 325-343, 498-538, 178-218, 567-607
are matched to blocks BL00154A-E(E1-E2 ATPases phosphorylation
site proteins).
Residues 585-609 are matched to block BL01228D, concerned with
Hypothetical cof family proteins, e.g. YIGL_ECOLI.
Residues 350-366 are matched to block PR00859A, concerned with
prokaryote metallothionein signature, e.g. MT_SYNP7.
Residues 636-657 are matched to block PR00488F, concerned with
Five-lipoxygenase activating protein signature, e.g. FLAP_RAT.

ProDom Summary:  Protein Domain Search
Residues 95-168, 203-340, 365-416, 417-451, 580-641, 648-672, 673-874,
constitute defined domains of ATCL_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 60 (E-value = 1.5e-11) place MG071 in the Cation_ATPase_N family which is described as Cation transporter/ATPase, N-terminus (PF00690)
Residues 83 to 321 (E-value = 3.2e-94) place MG071 in the E1-E2_ATPase family which is described as E1-E2 ATPase (PF00122)
Residues 325 to 610 (E-value = 3.9e-18) place MG071 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
35  
63
transmembrane  
77  
94
transmembrane  
271  
303
transmembrane  
650  
670
transmembrane  
692  
708
transmembrane  
739  
757
transmembrane  
806  
835

PDB Hit:


Gene Protein Sequence:
VNSWTGLSEQAAIKSRQEHGANFLPEKKATPFWLLFLQQFKSLVVILLLL
ASLLSFVVAIVSGLRSNWNFNHDLIIEWVQPFIILLTVFANSLIGSIQEF
KAQKSASALKSLTKSFTRVFRNGELISINVSEVVVGDIIFVDAGDIIPAD
GKLLQVNNLRCLESFLTGESTPVDKTIDSNEKATILEQTNLVFSGAQVVY
GSGVFQVEAVGIKTQVGKIAKTVDDSVTKLSPLQQKLEKIGKWFSWFGLG
LFAVVFLVQTALLGFDNFTNNWSIALIGAIALVVAIIPEGLVTFINVIFA
LSVQKLTKQKAIIKYLSVIETLGSVQIICTDKTGTLTQNQMKVVDHFCFN
STTQTDLARALCLCNNASISKDANKTGDPTEIALLEWKDRSQLDLKTYYR
VYEKAFDSIRKLMTVVVQKDNRFIVIVKGAPDVLLPLCNNVQNEVKNIEN
LLDQSAGQGLRTLAVALKVLYKFDQNDQKQIDELENNLEFLGFVSLQDPP
RKESKEAILACKKANITPIMITGDHLKTATVIAKELGILTLDNQAVLGSE
LDEKKILDYRVFARVTPQQKLAIVSAWKEAGFTVSVTGDGVNDAPALIKS
DVGCCMGITGVDIAKDASDLIISDDNFATIVNGIEEGRKTFLTCKRVLLN
LFLTSIAGTVVVLLGLFILGQVFKTNLLQQGHDFQVFSPTQLLIINLFVH
GFPAVALAVQPVKEKLMVGSFSTKNLFYNRQGFDLIWQSLFLSFLTLLFY
SLGIIYAINNRDLQTSGDLINRAGSTCGFFILGASAALNSLNLMVDKPLL
MTNPWFFKLVWIGSLASILVFLLIIFINPLGLVFNVLQDLTNHPVLISYS
FGGVILYMGMNEVVKLIRLGYGNI

Gene Nucleotide Sequence:  Sequence Viewer
GTGAACAGTTGAACAGGACTTAGTGAACAAGCGGCAATTAAAAGTCGTCA
AGAACATGGTGCTAATTTTCTTCCTGAGAAAAAAGCTACCCCTTTTTGGT
TGTTATTTCTTCAACAATTTAAAAGTTTAGTTGTTATTCTTTTACTGCTA
GCTAGCTTGTTATCGTTTGTAGTTGCTATTGTCAGTGGTTTGAGAAGTAA
CTGAAACTTTAACCATGATCTGATTATTGAATGGGTTCAACCTTTTATTA
TCTTATTAACTGTTTTTGCCAATTCACTAATTGGTTCTATCCAGGAATTT
AAAGCCCAGAAATCTGCTAGTGCTTTAAAGTCCTTGACAAAGTCTTTCAC
AAGGGTTTTTAGGAATGGTGAATTAATTAGCATTAATGTTAGTGAAGTTG
TTGTAGGAGATATTATTTTTGTTGATGCAGGAGATATTATCCCTGCTGAT
GGCAAATTACTACAGGTTAATAACTTACGTTGTTTGGAAAGCTTTTTAAC
TGGTGAATCAACTCCAGTTGATAAGACTATTGATAGCAATGAAAAAGCTA
CTATTCTTGAACAGACAAACTTAGTTTTTTCAGGGGCACAAGTAGTTTAT
GGTAGTGGCGTTTTTCAAGTGGAAGCAGTTGGGATTAAAACCCAAGTTGG
AAAAATTGCTAAAACTGTTGATGATAGTGTAACTAAACTCTCACCCTTAC
AACAAAAACTAGAGAAGATAGGAAAGTGATTTAGTTGGTTTGGGCTTGGT
CTTTTTGCTGTAGTTTTTCTTGTCCAAACTGCTTTATTAGGATTTGATAA
TTTCACTAATAACTGATCAATAGCTTTAATTGGTGCTATTGCGCTTGTTG
TTGCAATTATCCCTGAAGGGCTTGTTACTTTTATTAATGTGATCTTTGCA
TTAAGTGTGCAGAAACTAACTAAGCAAAAAGCCATTATTAAGTATTTATC
AGTAATTGAAACACTTGGATCAGTACAAATTATCTGTACTGATAAAACTG
GTACTTTAACCCAAAACCAGATGAAAGTTGTCGATCACTTCTGTTTTAAT
TCAACAACCCAAACTGATCTAGCAAGAGCATTGTGCTTGTGTAATAATGC
TTCTATTTCCAAAGATGCTAATAAAACAGGTGATCCTACTGAAATTGCTC
TCTTGGAATGAAAAGATCGCAGTCAATTAGATTTAAAAACCTATTACAGG
GTTTATGAAAAAGCCTTTGATTCAATCAGAAAACTTATGACAGTTGTTGT
TCAAAAAGACAACCGCTTCATTGTGATTGTTAAAGGTGCTCCTGATGTGT
TATTACCATTATGTAATAACGTTCAAAATGAAGTAAAGAACATTGAAAAC
TTACTTGATCAAAGTGCTGGTCAAGGCTTGCGTACCTTAGCAGTTGCTTT
AAAGGTTTTATATAAGTTTGATCAAAACGATCAGAAGCAAATTGATGAAC
TTGAAAACAACCTTGAATTCCTTGGGTTTGTTAGTTTACAAGACCCACCA
AGAAAAGAAAGTAAGGAAGCGATTTTAGCGTGCAAGAAAGCTAATATAAC
CCCAATAATGATTACAGGGGATCATCTTAAAACTGCAACTGTAATTGCTA
AAGAGTTAGGCATTTTAACTTTAGATAATCAAGCAGTTTTAGGTAGCGAA
CTAGATGAAAAGAAGATCTTGGATTACAGGGTATTTGCTAGAGTAACTCC
CCAACAAAAATTAGCCATTGTTAGTGCTTGAAAAGAAGCGGGATTTACAG
TTAGTGTTACTGGTGATGGGGTGAATGACGCACCTGCATTAATCAAGAGT
GATGTAGGGTGTTGTATGGGGATTACTGGGGTTGATATTGCAAAAGATGC
TAGTGATCTGATTATTAGTGATGATAATTTCGCTACTATAGTAAATGGTA
TTGAGGAGGGTAGAAAAACTTTTTTAACTTGTAAACGAGTTTTATTAAAC
CTGTTTTTAACTTCAATTGCAGGAACAGTTGTAGTTTTATTAGGACTATT
CATCTTAGGACAAGTTTTTAAAACTAATTTATTACAACAAGGTCATGACT
TTCAGGTGTTTAGTCCTACCCAACTGCTAATTATTAACTTGTTTGTTCAT
GGTTTTCCTGCTGTTGCATTAGCAGTACAACCTGTTAAAGAAAAATTGAT
GGTAGGTAGTTTTTCTACTAAAAATCTGTTTTACAACCGCCAGGGATTTG
ATTTAATCTGACAATCACTATTCTTAAGCTTTTTAACTTTATTGTTCTAT
AGCTTAGGAATTATATATGCAATTAATAACCGTGATTTACAAACTAGCGG
GGATCTAATTAATCGTGCTGGATCAACGTGCGGTTTTTTTATTTTGGGTG
CTAGTGCTGCTTTAAACTCATTAAACCTAATGGTAGATAAACCATTGCTT
ATGACAAACCCTTGGTTTTTTAAGTTAGTTTGAATAGGTTCACTTGCTTC
TATACTGGTATTTTTATTGATCATCTTTATCAACCCTTTAGGGTTAGTGT
TTAATGTCTTGCAAGATTTAACTAATCACCCAGTTTTAATAAGCTATAGT
TTTGGGGGAGTTATTTTGTATATGGGGATGAATGAAGTTGTTAAACTTAT
TAGATTAGGTTATGGCAATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy