Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR51 IGR50 IGR49 rps2, - MG070 pacL, - MG071 ptsG, - MG069 rps2, - MG070 pacL, - MG071 ptsG, - MG069 Type: direct, Name:  - 30 Type: direct, Name:  - 32 Type: direct, Name:  - 46 rps2, - MG070 pacL, - MG071 ptsG, - MG069 secA, - MG072 secA, - MG072
* Calculated from Protein Sequence

Gene ID: MG069

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptsG  

Definition:
PTS system, glucose-specific II ABC protein

Gene Start:
88228

Gene Stop:
90951

Gene Length:
2724

Molecular Weight*:
98395

pI*:
10.29

Net Charge*:
23.86

EC:
2.7.1.69  

Functional Class:
Transport and binding; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism
Carbohydrate Metabolism; Galactose metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Membrane Transport; Phosphotransferase system (PTS)
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to PTS system, glucose-specific IIABC protein
sequences, e.g. residues 5-908 are 72% similar to PTGA_MYCPN.
MG069 shows no significant similarities to C.trachomatis and
T.pallidum sequences.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 784-828 are matched to block BL00371, concerned with
PTS EIIA domain proteins phosphorylation site proteins, e.g. PTGA_MYCGE.
Residues 634-680 are matched to block BL01035A, concerned with
PTS EIIB domain proteins cysteine phosphorylation site proteins, e.g. PTGB_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 1-25, 26-253, 267-463, 464-539, 540-559, 572-600,
649-703, 708-727, 748-826, 827-908 constitute defined domains
of PTGA_MYCGE.In addition to hits to M.genitalium it also has
hits to PTGB_SALTY, PTGA_MYCPN.
Residues 481-588 are 30% similar to a TYPE-2 ANGIOTENSIN II
receptor domain represented by AG22_MOUSE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 28 to 528 (E-value = 1.7e-83) place MG069 in the PTS_EIIC family which is described as Phosphotransferase system, EIIC (PF02378)
Residues 634 to 668 (E-value = 1.7e-06) place MG069 in the PTS_EIIB family which is described as phosphotransferase system, EIIB (PF00367)
Residues 762 to 875 (E-value = 2.4e-11) place MG069 in the PTS_EIIA_1 family which is described as phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 (PF00358)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
32  
52
transmembrane  
76  
92
transmembrane  
98  
115
transmembrane  
151  
170
transmembrane  
184  
218
non-globular  
459  
506
transmembrane  
509  
538
transmembrane  
568  
591

PDB Hit:
gi|442961|pdb|1GPR| Glucose Permease (Domain Iia) (E.C.2.7.1.69)

Gene Protein Sequence:
MQISLVKIRNKFKQRNRGSFRQWVGKLSNGLMIPIAVLPLAGIFLGIGDA
ISSNSSGIVGVKFFGEFIKQGGNVVFANLPILFAVAIAITFSQDAGVAGF
SAFVFWATMNAFMSSLIIPVDANNTASGYNILYWKAVPQSAIASTLGLNS
LSTSVFGGIIVGALTAYLYNKFYAIRLPDVIGFFSGTRFVPIICMTIAIP
VALLLLMVWPGVSILLNLIGTGLGILGGRGYGANSLIFGYIERALIPFGV
HHAFYAPLWYTSAGGSLQEIANQQVWIRAPGSDYVTRVIGWEDFNTPGKW
VIPAALANGTSGMMNGATTTGQDSTSALSKYMSKESTNFLSWKELVDGLT
RKGNFDELAKNGLLDGSNKIWIGLNQSGILGKKVLLSDGKDYTITFKTFA
NTTPTFWSHGAHALLPISGTPSAITNGVTVNGTANSKTYNVSQFTVAVPS
LNPAQYSQGKFPFMLIGIPAAGLAMILAAPKGRRKEASSIIGSAAFTSFL
TGITEPFEFTFLFLAPWLFYGIHAVLAAVSFWLMNLLSANVGQTFSGSFI
DFILYGALPDGRGWLANSYLVPIIGIFLALIYFPTFYFLTIRFNLATPGR
GGKLITKKEYLAAKAAQKTDQTTNTNFNQTQIEAGMLLRAYGGSENIAEL
GACITKLRVTVKNPELVNETIIKDLGAAGVMRTTPTFFVAVFGTRAAVYK
SAMQDIIQGKVNWTELQKVLDKNDSTVEKPEIKPTPVLKVQDEIVILSPV
NGTLKPLTQVPDDTFKNRLVGDGIAILPSDGHFKAPGDVGVKTELAFPTG
HAFIFDVDGVKVMLHIGIDTVKINADKKPGEQLEVFDVKTKQGEYTKLKS
ESVVEVDLKKLKRKYDPITPFIVMQESLDNFKLVPIRQRGEIKVGQPLFK
LIYKDKKS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGATTAGTTTAGTTAAAATCCGCAATAAGTTTAAACAAAGAAACCG
TGGTTCTTTTCGTCAGTGAGTTGGTAAGCTTTCCAACGGTTTGATGATCC
CTATTGCAGTTTTGCCTTTAGCAGGTATTTTTTTAGGAATCGGTGATGCC
ATTTCTTCCAATTCATCTGGCATTGTTGGTGTGAAATTTTTTGGTGAATT
TATTAAACAAGGTGGTAATGTAGTTTTTGCTAACTTACCTATTTTGTTTG
CAGTTGCAATTGCGATCACCTTTTCTCAAGATGCAGGGGTTGCTGGATTT
TCTGCTTTTGTTTTTTGGGCCACAATGAACGCGTTTATGAGTTCATTAAT
TATTCCTGTTGATGCAAATAATACTGCTTCAGGTTATAACATCCTTTATT
GAAAAGCAGTACCTCAGTCAGCAATTGCTTCTACTTTAGGATTAAATTCA
CTTTCAACTTCAGTTTTTGGTGGGATTATAGTAGGGGCTTTAACTGCATA
TTTATATAACAAGTTTTATGCAATTAGATTGCCTGATGTAATTGGGTTTT
TTAGTGGTACTAGGTTTGTTCCTATTATTTGTATGACTATTGCTATTCCA
GTAGCATTACTTTTATTGATGGTTTGACCTGGTGTTTCTATCTTATTAAA
TTTAATAGGAACTGGGCTTGGAATCTTAGGTGGAAGAGGATATGGTGCTA
ACAGTTTAATCTTTGGATATATAGAAAGAGCACTAATTCCTTTTGGAGTA
CATCATGCCTTTTATGCACCATTATGATATACAAGTGCAGGCGGTAGTTT
GCAAGAAATTGCAAATCAACAAGTTTGGATTAGAGCTCCTGGTAGTGATT
ATGTAACCAGAGTGATAGGTTGAGAAGATTTTAATACTCCAGGAAAATGA
GTTATTCCTGCTGCTTTAGCTAATGGAACAAGTGGAATGATGAATGGAGC
TACTACAACAGGACAAGATAGTACATCTGCACTTTCAAAATACATGAGTA
AAGAATCAACAAACTTTCTAAGTTGAAAAGAACTTGTTGATGGTCTTACA
CGTAAAGGTAACTTTGATGAATTGGCTAAAAACGGTTTATTAGATGGTTC
TAACAAGATTTGAATTGGTTTAAACCAGTCAGGGATCTTAGGTAAAAAAG
TACTGTTAAGTGATGGTAAGGACTACACTATTACCTTTAAAACTTTTGCT
AACACCACGCCAACATTCTGAAGCCATGGTGCTCATGCACTTTTACCAAT
TAGTGGAACTCCAAGTGCAATAACTAATGGAGTTACTGTTAATGGTACTG
CTAATTCTAAAACCTATAATGTCAGTCAGTTCACTGTTGCAGTTCCTTCT
TTAAACCCAGCACAATATTCCCAAGGTAAATTCCCATTCATGCTAATTGG
AATTCCAGCAGCTGGACTTGCAATGATCTTAGCTGCTCCTAAGGGTAGAA
GAAAAGAAGCTAGTTCTATTATTGGTAGTGCTGCATTCACTAGTTTTCTA
ACAGGGATCACCGAACCTTTTGAATTTACCTTTCTTTTCTTAGCACCATG
GTTATTCTATGGTATCCACGCTGTATTAGCTGCAGTAAGCTTTTGATTAA
TGAACTTATTGAGTGCTAACGTTGGACAAACCTTCTCAGGTTCTTTCATT
GACTTTATCTTGTATGGGGCTTTACCTGATGGTAGGGGTTGATTAGCAAA
CTCTTACTTAGTACCTATTATTGGTATCTTTTTAGCATTGATTTATTTCC
CTACCTTCTATTTCTTGACAATTCGCTTTAACTTAGCAACTCCTGGTAGA
GGTGGTAAGTTAATTACTAAAAAGGAATATTTAGCAGCAAAAGCAGCTCA
AAAAACTGATCAAACTACTAACACTAACTTTAATCAAACCCAAATTGAAG
CTGGTATGTTACTAAGAGCTTATGGTGGAAGTGAAAACATTGCTGAATTA
GGGGCTTGCATTACTAAATTAAGAGTAACAGTTAAAAACCCTGAACTTGT
TAATGAAACTATTATTAAAGACTTGGGAGCAGCTGGGGTAATGCGTACCA
CTCCAACATTCTTTGTAGCAGTGTTTGGTACTCGAGCTGCTGTTTATAAA
TCAGCAATGCAAGATATTATCCAAGGCAAAGTAAATTGAACAGAGTTGCA
AAAAGTCTTAGATAAAAATGATAGTACTGTTGAAAAACCAGAAATAAAAC
CAACCCCAGTTTTAAAAGTTCAAGATGAAATTGTGATCCTCTCACCAGTT
AATGGCACCTTAAAACCGCTCACCCAAGTTCCTGATGATACCTTCAAAAA
TCGTTTGGTAGGAGATGGAATTGCTATCTTACCTAGCGATGGGCACTTCA
AAGCACCAGGTGATGTGGGTGTGAAAACTGAACTTGCTTTCCCTACTGGT
CATGCCTTTATCTTTGATGTTGATGGTGTGAAAGTAATGCTTCACATTGG
GATTGATACAGTAAAAATTAATGCTGATAAAAAACCAGGGGAACAACTTG
AAGTGTTTGATGTAAAAACAAAACAAGGAGAATACACTAAATTAAAGAGT
GAAAGTGTTGTTGAAGTTGATTTAAAGAAACTTAAACGAAAGTATGATCC
AATCACTCCTTTCATTGTGATGCAAGAATCACTTGATAACTTCAAGTTGG
TGCCAATTCGCCAACGTGGTGAAATTAAAGTTGGCCAACCTTTATTTAAA
CTAATTTATAAAGATAAGAAGAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy