Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR45 IGR46 IGR47 IGR48 IGR49 MG065 MG068 SPase, - MG067 tktA, - MG066 MG064 MG065 MG068 SPase, - MG067 tktA, - MG066 MG064 Type: inverted, Name:  - 57 Type: inverted, Name:  - 63 Type: inverted, Name:  - 66 MG065 MG068 SPase, - MG067 tktA, - MG066 MG064
* Calculated from Protein Sequence

Gene ID: MG066

DNA Molecule Name:
1  

Genbank ID:
1045741

Gene Name:
tktA  

Definition:
transketolase

Gene Start:
79090

Gene Stop:
81033

Gene Length:
1944

Molecular Weight*:
73777

pI*:
7.49

Net Charge*:
4.00

EC:
2.2.1.1  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle
Energy Metabolism; Methane metabolism

Comment:
This enzyme, together with transaldolase, provides a link between the glycolytic and pentose-phosphate pathways. The pentose phosphate pathway oxidizes Glucose-6-phosphate to generate NADPH.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to multiple transketolase sequences, e.g. residues 1-648 are 71 % similar to TKT_MYCPN (sp|P75611; MP0073).
MG066 is also similar to predicted transketolases from U. urealyticum UU586, C. trachomatis CT750 (tktB ortholog), C. pneumoniae CPn0893 and T.pallidum TP0560 (tktA).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0021 is EHgpCMYu.
COG name: Transketolase/pyruvate dehydrogenase E1 subunit.
Functional Class: C
BeTs to -hg-cmyu.

Blocks Summary:  Blocks Search
Residues 8-583 represent 8 matches to blocks BL00801A-I
(Transketolase proteins).

ProDom Summary:  Protein Domain Search
Residues 41-137, 138-469, 470-565, 566-620 constitute defined
domains of TKT_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 316 (E-value = 4.1e-61) place MG066 in the Transketolase_N family which is described as Transketolase, thiamine diphosphate binding domain (PF00456)
Residues 342 to 512 (E-value = 8.1e-49) place MG066 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)

PDB Hit:
gi|809440|pdb|1TKA|A Chain A, Transketolase (E.C.2.2.1.1) Complexed With 3'-Deazo-Thiamin Diphosphate And Calcium

Gene Protein Sequence:
MKYLYATQHLTLNAIKHAKGGHVGMAIGASPILFSLFTKHFHFDPDQPKW
INRDRFVLSAGHGSMALYSIFHFAGLISKQEILQHKHGQINTSSHPEYAP
NNFIDASTGPLGQGFGMAVGMVLAQKLLANEFKELSDKLFDHYTYVVVGD
GDLQEGVSYEVSQIAGLYKLNKLIVLHDSNRVQMDSEVKKVANENLKVRF
ENVGWNYIHTDDQLENIDQAIIKAKQSDKPTFIEVRTTIAKNTHLEDQYG
GHWFIPNEVDFQLFEKRTNTNFNFFNYPDSIYHWFKQTVIERQKQIKEDY
NNLLISLKDKPLFKKFTNWIDSDFQALYLNQLDEKKVAKKDSATRNYLKD
FLNQINNPNSNLYCLNADVSRSCFIKIGDDNLHENPCSRNIQIGIREFAM
ATIMNGMALHGGIKVMGGTFLAFADYSKPAIRLGALMNLPVFYVYTHDSY
QVGGDGPTHQPYDQLPMLRAIENVCVFRPCDEKETCAGFNYGLLSQDQTT
VLVLTRQPLKSIDNTDSLKTLKGGYILLDRKQPDLIIAASGSEVQLAIEF
EKVLTKQNVKVRILSVPNITLLLKQDEKYLKSLFDANSSLITIEASSSYE
WFCFKKYVKNHAHLGAFSFGESDDGDKVYQQKGFNLERLMKIFTSLRN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATACTTATATGCCACTCAACACCTTACTTTAAATGCTATTAAGCA
TGCTAAGGGAGGACATGTTGGCATGGCCATTGGTGCAAGTCCTATCTTAT
TTAGTTTATTTACTAAACACTTTCACTTTGATCCTGACCAACCAAAGTGG
ATCAACAGAGATCGCTTTGTTTTAAGTGCTGGCCATGGTAGCATGGCATT
ATATTCAATTTTCCATTTTGCCGGACTTATTTCTAAACAAGAGATCTTAC
AGCATAAACATGGTCAAATTAACACTTCTTCCCATCCTGAATATGCTCCA
AATAACTTCATAGATGCATCAACAGGCCCTTTAGGTCAAGGCTTTGGCAT
GGCAGTTGGCATGGTGTTAGCACAAAAGTTATTAGCTAATGAATTTAAAG
AGCTAAGTGATAAATTGTTTGACCATTACACCTATGTGGTTGTTGGGGAT
GGAGATCTACAGGAGGGGGTTAGTTATGAAGTTAGTCAAATTGCTGGGTT
ATATAAATTAAATAAACTAATTGTGCTTCATGATTCAAATAGAGTGCAAA
TGGATAGTGAAGTAAAAAAAGTTGCTAATGAAAATCTAAAGGTTAGGTTT
GAAAACGTTGGTTGGAATTACATCCATACTGATGATCAACTAGAAAATAT
TGATCAAGCTATTATTAAAGCCAAACAATCAGATAAGCCAACTTTTATTG
AAGTGAGAACAACTATTGCTAAAAACACCCACCTTGAAGATCAGTATGGA
GGACATTGGTTTATTCCCAATGAAGTGGACTTTCAACTTTTTGAGAAAAG
AACAAATACTAACTTTAACTTTTTTAATTATCCAGATAGTATTTACCACT
GATTCAAACAAACTGTTATTGAAAGACAAAAACAAATTAAAGAAGATTAC
AACAATTTGCTAATTTCTCTTAAAGACAAACCACTTTTTAAAAAATTTAC
TAATTGGATTGACAGTGATTTTCAAGCCCTTTATCTTAACCAACTAGATG
AAAAGAAAGTAGCAAAAAAAGATAGTGCTACTAGAAACTATTTAAAAGAT
TTTTTAAACCAAATTAATAATCCTAATTCCAACTTGTATTGCTTAAATGC
TGATGTATCACGTTCTTGTTTTATCAAGATAGGTGATGATAATCTCCATG
AAAATCCTTGTTCTAGAAATATCCAAATAGGAATTAGGGAGTTTGCAATG
GCAACAATAATGAATGGTATGGCACTTCATGGTGGTATTAAAGTGATGGG
TGGTACTTTTTTAGCATTTGCTGATTATTCAAAGCCAGCAATTCGCTTAG
GTGCATTAATGAACTTACCAGTATTTTATGTTTATACCCATGACTCTTAT
CAAGTAGGGGGTGATGGTCCTACTCATCAACCCTATGATCAACTACCAAT
GTTAAGAGCAATTGAAAATGTTTGTGTATTTCGTCCTTGTGATGAAAAGG
AAACTTGTGCTGGATTTAACTATGGTCTTTTAAGTCAAGATCAGACAACT
GTTTTGGTTTTAACACGTCAACCCTTAAAATCCATTGATAACACTGATAG
TTTAAAAACACTGAAGGGTGGTTATATCCTTTTGGATAGAAAACAACCTG
ATTTAATTATTGCTGCTAGTGGTAGTGAAGTGCAACTTGCAATAGAGTTT
GAAAAAGTTTTAACTAAACAAAATGTAAAGGTAAGAATTCTGTCAGTTCC
CAATATAACTTTACTTTTAAAACAAGATGAAAAATATCTAAAGAGTTTAT
TTGATGCTAACAGTTCACTTATCACCATAGAAGCTAGTAGTAGCTATGAG
TGGTTTTGCTTTAAGAAGTATGTTAAAAACCATGCTCATTTAGGAGCTTT
TAGTTTTGGTGAATCTGATGATGGAGATAAAGTTTATCAGCAAAAAGGGT
TTAATCTGGAAAGGTTAATGAAAATATTTACTTCCCTAAGAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy