Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR45 IGR43 IGR42 IGR44 uhpT, - MG061 fruK, - MG063 MG060 MG065 fruA, - MG062 MG064 uhpT, - MG061 fruK, - MG063 MG060 MG065 fruA, - MG062 MG064 Type: tandem, Name:  - 1 Type: inverted, Name:  - 51 uhpT, - MG061 fruK, - MG063 MG060 MG065 fruA, - MG062 MG064
* Calculated from Protein Sequence

Gene ID: MG063

DNA Molecule Name:
1  

Genbank ID:
3844659

Gene Name:
fruK  

Definition:
1-phosphofructokinase

Gene Start:
72668

Gene Stop:
73432

Gene Length:
765

Molecular Weight*:
28499

pI*:
8.97

Net Charge*:
2.43

EC:
2.7.1.56  

Functional Class:
Energy metabolism; Glycolysis and Gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism
Carbohydrate Metabolism; Galactose metabolism

Comment:
It belongs to a family of carbohydrate kinases that groups together PFKB, FRUK, GSK, LACC, RBSK and SCRK.



Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to 1-phosphofructokinase sequences,
e.g. residues 1-255 are 56% similar to FRUK_MYCPN (MP0076).
MG063 shows no significant similarities to C. trachomatis, C. pneumoniae, U. urealyticum and T. pallidum sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0524 is EHgpCmYu.
COG name: Sugar kinases.
Functional Class: G
BeTs to -hg-cmyu.

Blocks Summary:  Blocks Search
Residues 195-208 are member of block BL00583B(pfkB family of
carbohydrate kinases proteins).

ProDom Summary:  Protein Domain Search
Residues 1-90 constitute defined domain of FRUK_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 245 (E-value = 1.3e-05) place MG063 in the PfkB family which is described as pfkB family carbohydrate kinase (PF00294)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
255

PDB Hit:


Gene Protein Sequence:
MKSLGFDPTVITFLGQPTKNLFLELVKPYDLNIVSFISETKTRINLKLLK
DEKTTEINDLSPLITDANLTELLTFLKANVKNNDLVIINGRFKFEALEKV
LNLVFTLTENVVIDVDESKMLTLLNQSKPLVMKPNIDEFQTMINTFFHDQ
QSLIAAIKKFHYCKLLLLSDGDKGAYLFDQNKLLFVSSITPKQVVSTTGA
GDTLLAVFLANLILKVDLKTALIKATNYASATISKLGVVDSKDKISVITP
KSYYL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATCACTTGGTTTTGATCCAACTGTCATTACTTTTTTGGGACAACC
CACTAAAAACTTATTTTTAGAGTTGGTAAAACCTTATGATCTAAATATAG
TTAGCTTCATTTCTGAAACTAAAACAAGAATTAACCTTAAGTTATTAAAA
GATGAAAAAACTACTGAAATTAATGATTTAAGTCCTTTAATAACAGATGC
TAATCTAACTGAATTGTTAACTTTTTTAAAAGCTAATGTTAAGAATAATG
ATTTGGTTATCATCAACGGAAGATTTAAATTTGAAGCTTTAGAAAAAGTT
CTAAACTTGGTCTTTACATTAACAGAAAATGTGGTTATAGATGTTGATGA
AAGCAAAATGTTAACGCTTTTAAATCAGTCTAAACCACTAGTTATGAAAC
CTAACATTGATGAGTTTCAAACTATGATTAATACTTTTTTTCACGATCAA
CAAAGCTTAATAGCAGCAATTAAAAAATTTCATTACTGTAAGCTCTTATT
ATTATCTGATGGTGACAAAGGAGCTTATCTTTTTGATCAGAATAAGTTAT
TGTTTGTAAGTTCTATCACTCCTAAACAAGTAGTTAGCACCACAGGAGCA
GGTGATACTTTGTTGGCAGTTTTTTTAGCAAATTTGATTCTAAAGGTAGA
TTTAAAAACTGCTTTGATTAAAGCAACTAACTATGCAAGTGCAACAATTA
GTAAGTTAGGTGTTGTTGATAGTAAAGACAAAATTAGTGTTATAACCCCA
AAAAGTTACTATTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy