Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-1 IGR41 IGR40 IGR43 IGR42 IGR44 smpB, - MG059 prs, - MG058 uhpT, - MG061 fruK, - MG063 MG060 fruA, - MG062 MG064 smpB, - MG059 prs, - MG058 uhpT, - MG061 fruK, - MG063 MG060 fruA, - MG062 MG064 Type: tandem, Name:  - 1 Type: inverted, Name:  - 51 smpB, - MG059 prs, - MG058 uhpT, - MG061 fruK, - MG063 MG060 fruA, - MG062 MG064
* Calculated from Protein Sequence

Gene ID: MG062

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fruA  

Definition:
fructose-permease II ABC component

Gene Start:
70531

Gene Stop:
72570

Gene Length:
2040

Molecular Weight*:
74082

pI*:
10.00

Net Charge*:
18.32

EC:
2.7.1.69  

Functional Class:
Transport and binding; Carbohydrates, organic alcohols, and acids  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism
Carbohydrate Metabolism; Galactose metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Membrane Transport; Phosphotransferase system (PTS)
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism
Nucleotide Metabolism; Aminosugars metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to PTS system, fructose specific IIABC
component, e.g. residues 1-680 are 66% similar to PTFA_MYCPN.
MG062 shows weak similarity to T.pallidum TP0085 and TP0755
(PTS system, nitrogen regulatory IIA component (ptsN)).It is
also similar to C.trachomatis nitrogen regulatory IIA protein
sequences CT291 and CT290.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
Residues 640-658 are matched to block PR00344C, concerned with
bacterial sensor protein c-terminal signature, e.g. NTRB_RHOCA.

ProDom Summary:  Protein Domain Search
Residues 1-156, 491-621, 375-490, 169-249, 326-374, 268-299,
300-325 constitute defined domains of PTFB_MYCGE. Residues
271-388, 315-645, 343-422, 397-434 support this assignment,
e.g. PTVB_ECOLI, PTYC_ECOLI.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 11 to 149 (E-value = 1.5e-05) place MG062 in the PTS_EIIA_2 family which is described as Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359)
Residues 167 to 270 (E-value = 5.5e-67) place MG062 in the PTS_IIB_fruc family which is described as PTS system, Fructose specific IIB subunit (PF02379)
Residues 303 to 598 (E-value = 2e-62) place MG062 in the PTS_EIIC family which is described as Phosphotransferase system, EIIC (PF02378)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
302  
326
transmembrane  
352  
372
transmembrane  
414  
433
transmembrane  
451  
476
transmembrane  
480  
502
transmembrane  
593  
625
transmembrane  
642  
664

PDB Hit:


Gene Protein Sequence:
MFKNLLRPSLFFNWSQKTFKNKFSFLKQAANALQKQAVINDNNVAFEALK
KREEEITTGIITSLALPHLQSQSVIEPFVAVFKVKNLDWQSLDQKPVKLI
FLIGVLVDKTNLHLDFISNFSKLMLNETFASKVLNVTSYNGLIKLIDLFN
QQKVQDQPAVETKKEYDFVAVTACPTGIAHTFMAKEALEAFAKKHNLYVK
VETQGTDGIQNQLTSDDINNAKGVILACDRLIDFSRFYANKNVIEVSTTK
AIKKPDEVYELIKNQKGKQLANSAKPTNQTQLAESEGEFNFNNFHKRIYR
AILSGVSYMLPFVVFGGILIALSFLIDINNANNAGGNFGTINPVANWLNK
LGGISFSLIVPILSAYIAYALVSRQGLLPGFVVGLISSGQFLLNIVLTNG
TIEWLAPSQVSSGFFGAIFGGLLSACLIIVQQNYIYKKLPQSLQGIKNIL
FIPLFGTLFTAGLFWVINIPLIYLNYGLSLFLNIMNSPILAPLLGFVIGL
MMCFDLGGPINKAAYVFGVVSLQNQNAGTISMAAAMLSGMVPPLSIALAA
SIRKSCFDKQELPAAYACYLMGLSFISEGAIPFVVKKPKVMLTANLIAGA
ICGALTGAFALSIRAPHGGVFVFALLKTTLQGIEGATLQTGVGIGLALVC
LIISMIVGSSIIIGYDLIAKHNQRKQNLNS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTAAAAATTTATTAAGACCATCCCTATTTTTTAACTGGAGCCAAAA
AACATTTAAAAATAAATTTTCGTTTTTAAAACAAGCAGCAAATGCATTAC
AAAAACAGGCTGTTATCAATGATAACAATGTTGCATTTGAAGCTTTAAAA
AAGCGTGAAGAAGAGATTACAACTGGAATTATTACTAGTTTAGCTTTACC
TCACTTACAAAGTCAAAGTGTTATAGAACCTTTTGTTGCTGTATTTAAGG
TTAAAAACTTAGATTGACAATCATTAGATCAAAAACCAGTTAAATTGATA
TTTTTAATTGGTGTTCTTGTTGACAAAACCAATTTGCATCTTGATTTCAT
TAGTAACTTTTCCAAGTTAATGTTGAATGAAACATTTGCAAGTAAGGTTT
TAAATGTCACTAGCTATAACGGCTTGATTAAACTAATTGATCTTTTTAAC
CAACAAAAAGTGCAAGACCAACCAGCTGTTGAAACAAAAAAAGAGTATGA
CTTTGTTGCTGTAACAGCATGCCCAACTGGCATTGCCCATACTTTCATGG
CTAAAGAAGCGTTGGAAGCATTTGCAAAAAAGCATAACTTATATGTAAAA
GTTGAAACTCAAGGTACAGATGGGATACAAAATCAACTTACAAGTGACGA
TATTAATAACGCTAAAGGTGTTATTCTTGCTTGTGATCGTTTAATTGATT
TCTCTAGGTTTTATGCAAATAAGAATGTGATTGAAGTGTCAACTACTAAA
GCCATTAAAAAACCTGATGAGGTGTATGAATTAATTAAAAACCAAAAGGG
TAAACAGCTTGCAAATAGTGCTAAACCAACTAATCAAACCCAATTAGCTG
AAAGTGAAGGGGAATTCAACTTTAATAATTTTCACAAGCGGATTTATCGT
GCCATTTTAAGTGGTGTTTCTTACATGCTACCATTCGTTGTTTTTGGTGG
GATATTAATTGCACTCTCTTTTCTAATTGATATAAATAACGCTAATAATG
CTGGTGGTAACTTTGGCACAATTAATCCTGTTGCTAACTGGTTAAATAAG
CTAGGAGGAATTTCCTTTAGTTTAATTGTTCCTATCTTATCTGCATACAT
TGCATATGCATTGGTATCAAGACAGGGATTATTACCTGGTTTTGTTGTTG
GTTTAATCTCTTCAGGACAATTTTTATTAAATATTGTTCTGACCAATGGA
ACAATTGAATGGTTAGCACCATCACAAGTATCAAGTGGCTTTTTTGGTGC
TATCTTTGGAGGACTTTTGAGTGCTTGCTTAATAATTGTTCAACAAAACT
ACATCTATAAAAAATTACCTCAATCTTTGCAGGGAATTAAAAACATCTTG
TTTATTCCCTTGTTTGGTACTTTATTCACTGCTGGTTTATTTTGGGTTAT
TAACATTCCTTTAATTTATCTAAACTATGGATTAAGTCTGTTTTTAAATA
TTATGAACAGCCCTATCCTAGCACCTTTACTTGGTTTTGTAATTGGGTTG
ATGATGTGCTTTGATTTAGGGGGGCCAATTAATAAAGCAGCTTATGTTTT
TGGTGTTGTTTCTTTACAAAATCAAAATGCAGGAACAATTTCGATGGCTG
CAGCTATGCTATCAGGGATGGTACCTCCTTTATCAATTGCTTTGGCAGCT
TCCATTCGAAAGAGCTGCTTTGATAAACAGGAATTACCTGCAGCTTATGC
TTGTTATCTGATGGGATTGAGTTTTATTAGTGAAGGTGCTATCCCATTTG
TTGTTAAAAAACCTAAGGTGATGTTAACTGCTAACTTAATTGCTGGAGCA
ATTTGTGGAGCATTAACAGGAGCATTTGCCTTATCAATTCGTGCTCCTCA
TGGCGGTGTTTTTGTGTTTGCACTTTTAAAAACTACTTTACAAGGGATTG
AAGGAGCTACATTACAAACTGGAGTTGGCATTGGTTTGGCATTGGTTTGT
TTAATAATTAGTATGATAGTTGGTAGTAGTATTATCATTGGCTATGACTT
GATTGCAAAACATAACCAAAGAAAGCAAAATCTGAATAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy