Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR37 IGR38 IGR35 IGR36 IGR40 rpL33, - MG055.1 MG055 smpB, - MG059 MG056 prs, - MG058 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 deoA, - MG051 manB, - MG053 rpL33, - MG055.1 MG055 smpB, - MG059 MG056 prs, - MG058 nusG, - MG054 ffh, - MG048 cdd, - MG052 deoD, - MG049 deoA, - MG051 manB, - MG053 Type: inverted, Name:  - 65 MG055 smpB, - MG059 MG056 prs, - MG058 nusG, - MG054 ffh, - MG048 MG055.2 MG057 MG057 rpL33, - MG055.1 MG055.2 cdd, - MG052 deoD, - MG049 deoA, - MG051 manB, - MG053 deoC, - MG050 deoC, - MG050
* Calculated from Protein Sequence

Gene ID: MG053

DNA Molecule Name:
1  

Genbank ID:
1045726

Gene Name:
manB  

Definition:
phosphomannomutase

Gene Start:
61407

Gene Stop:
63056

Gene Length:
1650

Molecular Weight*:
63388

pI*:
8.73

Net Charge*:
6.98

EC:
5.4.2.8  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannose metabolism

Primary Evidence:
Tham,T.N., Ferris,S., Kovacic,R., Montagnier,L. and Blanchard,A. 1993. Identification of Mycoplasma pirum genes involved in the salvage pathways for nucleosides. J. Bacteriol. 175(16): 5281-5285. Medline: 8349569.

Secondary Evidence:
Dwivedi K, Post AF, Bullerjahn GS. 1996. Cloning and functional analysis of the pmmA gene encoding
phosphomannomutase from the photosynthetic prokaryote
Prochlorothrix hollandica. Biochim Biophys Acta 1290(3):210-4. Medline: 8765122. Published erratum appears in Biochim Biophys Acta 1996 Dec 6;1291(3):252.

Coyne MJ Jr, Russell KS, Coyle CL, Goldberg JB. 1994. The Pseudomonas aeruginosa algC gene encodes phosphoglucomutase, required for the synthesis of a complete lipopolysaccharide core. J Bacteriol 176(12):3500-7. Medline: 7515870.

Jayaratne P, Bronner D, MacLachlan PR, Dodgson C, Kido N, Whitfield C. 1994. Cloning and analysis of duplicated rfbM and rfbK genes involved in the formation of GDP-mannose in Escherichia coli O9:K30 and participation of rfb genes in the synthesis of the group I K30 capsular polysaccharide. J Bacteriol 176(11):3126-39. Medline: 7515042.

Comment:
Phosphomannomutase converts mannose-1-phosphate to
mannose-6-phosphate.

Blast Summary:  PSI-Blast Search
MG053 is orthologously related to MP0088: residues 6-550 of MG053 are 61% similar to residues 7-554 of MP0088, a predicted phosphomannomutase from M. pneumoniae. MG053 is also similar to
predicted phosphomannomutases in U. urealyticum (UU530), C. pneumoniae (CPn0056), T. pallidum (TP0642), C. trachomatis (CT295), and Mycoplasma pirum (1086119). MG053 has weaker similarity to predicted phosphoglucomutases from C. pneumoniae (CPn0967), C. trachomatis (CT815), and T. pallidum (TP0413).

Hits in gapped BLAST to predicted phosphomannomutases in Bacillus subtilis (2851553), Streptococcus pneumoniae (gb|AAD56627.1), Haemophilus influenzae (2499516), Borrelia burgdorferi (2688773), Haemophilus ducreyi (3929019), Pseudomonas aeruginosa (113630), among others.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0033 is EHgpCMYU.
COG name: Phosphglucomutase/phosphomannomutase.
Functional Class: G
BeTs to -hg-cmyu.

Blocks Summary:  Blocks Search
Residues 56-518 represent 5 matches to blocks BL00710A-D
(Phosphoglucomutase and phosphomannomutase phosphoserine signa).
Residues 206-224 are matched to block BL01121A, concerned with
Caspase family histidine proteins, e.g. ICE7_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 200-547, 88-164, 8-78, 174-199 constitute defined domains of CPSG_MYCGE. Residues 71-160, 284-539 support this assignment,
e.g. RFBK_SALTY.

Paralogs:  Local Blast Search
No evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 41 to 186 (E-value = 1.3e-46) place MG053 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
35

PDB Hit:
gi|1310948|pdb|3PMG|A Chain A, Phosphoglucomutase Mol_id: 1; Molecule: Alpha-D-Glucose-1,6-Bisphosphate; Chain: A, B; Synonym: Phosphoglucomutase; Ec: 5.4.2.2; Heterogen: Mg

Gene Protein Sequence:
MDKLRLEVERWLNHPNVNWELKQQIKELNESEIQELFSLEKPLFGTAGVR
NKMAPGYHGMNVFSYAYLTQGYVKYIESINEPKRQLRFLVARDTRKNGGL
FLETVCDVITSMGHLAYVFDDNQPVSTPLVSHVIFKYGFSGGINITASHN
PKDDNGFKVYDHTGAQLLDTQTNQLLSDLPCVTSMLDLELQPNPKFVHTL
DNEKVYKNYFRELKKVLVINNNNFKDIKVVFSGLNGTSVCLMQRFLKYLG
YSNIISVEEQNWFDENFENAPNLNPEYKDTWILAQKYAKKNNAKLIIMAD
PDADRFAIAELNNNQWHYFSGNETGAITAYYKLNHKVFKSPYIVSTFVST
YLVNKIAKRYGAFVHRTNVGFKYIGQAINELSQTNELVVGFEEAIGLITS
DKLNREKDAYQAAALLLEIARHCKEQNITLLDFYKRILSEFGEYFNLTIS
HPFKATATDWKEEIKALFNQLINANLTEVAGFKVVKVHLDKQTNILEFGF
ENGWVKFRFSGTEPKLKFYFDLTNGTREALEKQAKKIYKFFVNLLKLNKA


Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAACTTAGATTAGAAGTTGAAAGATGGTTAAATCATCCTAATGT
TAATTGGGAGTTAAAACAACAAATTAAGGAGTTGAATGAATCAGAAATTC
AAGAACTTTTTAGTTTGGAAAAACCTTTATTTGGCACTGCAGGTGTAAGA
AACAAAATGGCACCAGGTTATCATGGTATGAATGTTTTTTCTTATGCCTA
TTTGACCCAAGGTTATGTTAAGTACATTGAATCCATCAATGAACCAAAGC
GTCAACTACGGTTTTTAGTAGCACGTGATACAAGAAAAAATGGTGGTTTA
TTTTTAGAAACGGTTTGTGATGTAATTACATCTATGGGTCATTTGGCTTA
TGTGTTTGATGATAACCAGCCAGTTTCAACACCTCTAGTGTCCCATGTCA
TTTTTAAATATGGTTTTAGTGGAGGTATTAATATCACAGCTAGCCATAAC
CCTAAAGATGATAATGGTTTTAAGGTTTATGATCATACTGGTGCACAGCT
TTTAGACACACAAACAAACCAATTGTTAAGTGATTTACCTTGTGTTACAT
CTATGCTAGATTTGGAATTACAACCAAATCCAAAGTTTGTCCATACTCTT
GACAATGAAAAGGTTTATAAAAACTATTTCAGAGAGTTGAAAAAGGTGTT
GGTTATTAACAACAACAATTTCAAAGACATTAAGGTAGTTTTTAGTGGGC
TTAATGGGACTTCAGTTTGCTTAATGCAACGCTTTTTAAAGTACCTTGGT
TATAGCAATATTATCAGTGTTGAGGAACAAAATTGGTTTGATGAGAATTT
TGAAAATGCTCCTAACTTAAATCCAGAGTATAAAGATACATGGATATTAG
CACAAAAATATGCTAAGAAAAATAATGCTAAGTTAATTATTATGGCAGAC
CCTGATGCTGATAGATTTGCAATTGCAGAGTTAAATAATAATCAATGACA
TTATTTTTCAGGTAATGAAACAGGAGCAATTACTGCTTACTATAAACTTA
ATCATAAGGTTTTTAAATCACCTTACATTGTCTCAACTTTTGTCTCAACT
TATTTGGTAAATAAGATTGCTAAAAGATATGGCGCTTTTGTGCATAGAAC
CAATGTTGGTTTTAAGTACATTGGTCAAGCAATTAATGAGTTATCACAAA
CAAACGAATTAGTTGTTGGTTTTGAAGAGGCAATTGGTTTAATAACTAGT
GATAAATTAAACCGCGAGAAAGATGCTTATCAAGCTGCTGCATTATTGCT
TGAGATTGCTAGACATTGCAAAGAACAAAACATCACGCTTTTAGATTTTT
ATAAAAGAATTCTTTCTGAGTTTGGTGAATATTTCAATTTAACAATATCT
CATCCCTTTAAAGCTACTGCTACTGATTGAAAAGAAGAGATTAAAGCTTT
ATTTAATCAACTTATAAATGCTAATTTAACTGAAGTGGCTGGTTTTAAAG
TAGTTAAAGTCCATCTTGATAAACAAACAAATATCTTAGAGTTTGGTTTT
GAAAATGGCTGGGTTAAATTCCGCTTTTCAGGTACTGAACCTAAATTGAA
ATTTTACTTTGACCTAACTAATGGCACTAGAGAGGCTCTAGAAAAGCAAG
CTAAGAAAATTTATAAATTCTTTGTAAATTTACTCAAACTCAACAAAGCT



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy